Align Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate WP_110804036.1 C8J30_RS01990 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q72L52 (376 letters) >NCBI__GCF_003217355.1:WP_110804036.1 Length = 361 Score = 296 bits (758), Expect = 6e-85 Identities = 179/362 (49%), Positives = 230/362 (63%), Gaps = 15/362 (4%) Query: 1 MAKVRLEHVWKRFGKVVAVKDFNLETEDGEFVVFVGPSGCGKTTTLRMIAGLEEISEGNI 60 MA ++L V K +G+V ++D NL+ + GE +VFVGPSGCGK+T LRMIAGLE IS G + Sbjct: 1 MADLKLTRVGKSYGEVDVLRDINLDIKAGELIVFVGPSGCGKSTLLRMIAGLERISAGEL 60 Query: 61 YIGDRLVNDVPPKDRDIAMVFQNYALYPHMNVYENMAFGLRLRRYPKDEIDRRVKEAARI 120 I VND+PP R IAMVFQ+YALYPHM V +NM F L++ + + +ID+ V+ AARI Sbjct: 61 RIDGVRVNDMPPAQRGIAMVFQSYALYPHMTVRQNMEFALKIAKKTRQDIDKAVENAARI 120 Query: 121 LKIEHLLNRKPRELSGGQRQRVAMGRAIVREPKVFLMDEPLSNLDAKLRVEMRAEIAKLQ 180 L++ L+R P+ LSGGQRQRVA+GRAIVR+PKV+L DEPLSNLDA LRV R EIA+L+ Sbjct: 121 LQLTPYLDRLPKALSGGQRQRVAIGRAIVRDPKVYLFDEPLSNLDAALRVATRIEIAQLK 180 Query: 181 RRLGV-TTIYVTHDQVEAMTLGHRIVVMKDGEIQQVDTPLNLYDFPANRFVAGFIGSPSM 239 + T IYVTHDQVEAMTL RIVV+ + I QV TPL LY+ P FVA FIGSP M Sbjct: 181 EAMPERTMIYVTHDQVEAMTLASRIVVLANKGIAQVGTPLELYEKPETEFVAQFIGSPQM 240 Query: 240 NFVRAGVEVQGE-KVYLVAPGFRIRANAVLGSALKPYAGKEVWLGVRPEHLGLKGYTTIP 298 N + + G V + G R+ A G V +GVRPE L T+ Sbjct: 241 NLLPGVIRETGAVTVVALDDGGTARSTVPTSPA---DLGLRVNIGVRPEDL------TVI 291 Query: 299 EEENVLRGEVEVVEPLGAETEIHVAV--NGTLLVAKVDG-HAPVKPGDKVELLADTQRLH 355 E + G VE+VE LG T ++ A +VAK+ G HA ++ V L A +++H Sbjct: 292 TEGGLFTGVVEIVEALGEVTLLYFAAKPGEPHMVAKLPGIHAGLR-HSTVGLTAAPEKVH 350 Query: 356 AF 357 F Sbjct: 351 LF 352 Lambda K H 0.320 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 361 Length adjustment: 30 Effective length of query: 346 Effective length of database: 331 Effective search space: 114526 Effective search space used: 114526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory