Align MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized)
to candidate WP_110804036.1 C8J30_RS01990 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q00752 (377 letters) >NCBI__GCF_003217355.1:WP_110804036.1 Length = 361 Score = 278 bits (712), Expect = 1e-79 Identities = 175/376 (46%), Positives = 224/376 (59%), Gaps = 28/376 (7%) Query: 1 MVELNLNHIYKKYPNSSHYSVEDFDLDIKNKEFIVFVGPSGCGKSTTLRMVAGLEDITKG 60 M +L L + K Y + D +LDIK E IVFVGPSGCGKST LRM+AGLE I+ G Sbjct: 1 MADLKLTRVGKSYGEVD--VLRDINLDIKAGELIVFVGPSGCGKSTLLRMIAGLERISAG 58 Query: 61 ELKIDGEVVNDKAPKDRDIAMVFQNYALYPHMSVYDNMAFGLKLRHYSKEAIDKRVKEAA 120 EL+IDG VND P R IAMVFQ+YALYPHM+V NM F LK+ +++ IDK V+ AA Sbjct: 59 ELRIDGVRVNDMPPAQRGIAMVFQSYALYPHMTVRQNMEFALKIAKKTRQDIDKAVENAA 118 Query: 121 QILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAK 180 +IL LT +L+R P LSGGQRQRVA+GRAIVRD KV+L DEPLSNLDA LRV+ R EIA+ Sbjct: 119 RILQLTPYLDRLPKALSGGQRQRVAIGRAIVRDPKVYLFDEPLSNLDAALRVATRIEIAQ 178 Query: 181 IHRRI-GATTIYVTHDQTEAMTLADRIVIMSSTKNEDGSGTIGRVEQVGTPQELYNRPAN 239 + + T IYVTHDQ EAMTLA RIV++++ + QVGTP ELY +P Sbjct: 179 LKEAMPERTMIYVTHDQVEAMTLASRIVVLANK----------GIAQVGTPLELYEKPET 228 Query: 240 KFVAGFIGSPAMNFFDVTIKDGHLVSKDGLTIAVTEG---QLKMLESKGFKNKNLIFGIR 296 +FVA FIGSP MN I++ V+ +A+ +G + + S + G+R Sbjct: 229 EFVAQFIGSPQMNLLPGVIRETGAVT----VVALDDGGTARSTVPTSPADLGLRVNIGVR 284 Query: 297 PEDISSSLLVQETYPDATVDAEVVVSELLGSETMLYL--KLGQTEFAARVDARDFHEPGE 354 PED++ ++ E V + E LG T+LY K G+ A++ Sbjct: 285 PEDLT---VITE---GGLFTGVVEIVEALGEVTLLYFAAKPGEPHMVAKLPGIHAGLRHS 338 Query: 355 KVSLTFNVAKGHFFDA 370 V LT K H F A Sbjct: 339 TVGLTAAPEKVHLFHA 354 Lambda K H 0.318 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 361 Length adjustment: 30 Effective length of query: 347 Effective length of database: 331 Effective search space: 114857 Effective search space used: 114857 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory