Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_110805339.1 C8J30_RS08100 ABC transporter ATP-binding protein
Query= SwissProt::Q9YGA6 (372 letters) >NCBI__GCF_003217355.1:WP_110805339.1 Length = 348 Score = 255 bits (651), Expect = 1e-72 Identities = 138/292 (47%), Positives = 194/292 (66%), Gaps = 15/292 (5%) Query: 1 MAGVRLVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQI 60 M+ + L + K FG + V++ +L V+ GEF+ LLGPSGCGKTT LRM+AG E P+ G I Sbjct: 1 MSYLSLTHLEKSFGTLRVVKDFNLTVEKGEFISLLGPSGCGKTTVLRMVAGFELPTSGAI 60 Query: 61 YIGDKLVADPEKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRV 120 I K V D + P R+I MVFQ+YAL+P++TV N+ F LK++ P+ ID+RV Sbjct: 61 TIAGKEVTD------LKPNQRNIGMVFQAYALFPNLTVAQNVGFGLKVKGTPKAAIDKRV 114 Query: 121 REVAELLGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRA 180 E+ L+GL +L NR P +LSGGQ+QRVAL RA+ KP V L+DEPLS LDAK+RV +R Sbjct: 115 EEMLSLIGLPDLGNRYPFQLSGGQQQRVALARALAPKPSVLLLDEPLSALDAKVRVSLRN 174 Query: 181 ELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDKPANTFVAGFI 240 E++ +QR+LG+TTI+VTHDQ EA++M DR+ VM+ G+ QVG+P ++Y++P+ FVA F+ Sbjct: 175 EIRAIQRELGITTIFVTHDQEEALSMSDRVVVMHEGIADQVGTPFDIYNRPSTRFVASFV 234 Query: 241 GSPPMNFLDAIVTEDGFVDFGEFRLKLLPDQFEVLGELGYVGREVIFGIRPE 292 G+ +N L+ V +D R+KL E+ V G+RPE Sbjct: 235 GT--LNTLNVQV-----LDAANGRVKL--GATEIALGRSLPSGPVTLGLRPE 277 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 348 Length adjustment: 29 Effective length of query: 343 Effective length of database: 319 Effective search space: 109417 Effective search space used: 109417 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory