Align TreV, component of Trehalose porter (characterized)
to candidate WP_110804036.1 C8J30_RS01990 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_003217355.1:WP_110804036.1 Length = 361 Score = 227 bits (578), Expect = 4e-64 Identities = 130/306 (42%), Positives = 187/306 (61%), Gaps = 29/306 (9%) Query: 3 VELIDIVKKYGKNIVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGKIIAD 62 ++L + K YG+ V+ I I+ GE V +GPSG GKSTLL+++AG+E++ G++ D Sbjct: 4 LKLTRVGKSYGEVDVLRDINLDIKAGELIVFVGPSGCGKSTLLRMIAGLERISAGELRID 63 Query: 63 GADITDKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKAAKLLGI 122 G + D PP +R +AMVFQ+YALYP+M+VR N+ F LK+ +++I + VE AA++L + Sbjct: 64 GVRVNDMPPAQRGIAMVFQSYALYPHMTVRQNMEFALKIAKKTRQDIDKAVENAARILQL 123 Query: 123 SEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELKRIQKEL 182 + LD+ +SGGQ+QRVA+ RAIVR+P +L DEPLSNLDA +R R E+ ++++ + Sbjct: 124 TPYLDRLPKALSGGQRQRVAIGRAIVRDPKVYLFDEPLSNLDAALRVATRIEIAQLKEAM 183 Query: 183 -KGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFVGEFPMNFL 241 + T IYVTHDQ EA++LA RI +L QV P LYE P+T++VAQF+G MN L Sbjct: 184 PERTMIYVTHDQVEAMTLASRIVVLANKGIAQVGTPLELYEKPETEFVAQFIGSPQMNLL 243 Query: 242 PGELMKEKA--------------------------QEIGFRPEWVEV--GKGNLSCMVES 273 PG + + A IG RPE + V G + +VE Sbjct: 244 PGVIRETGAVTVVALDDGGTARSTVPTSPADLGLRVNIGVRPEDLTVITEGGLFTGVVEI 303 Query: 274 VEASGE 279 VEA GE Sbjct: 304 VEALGE 309 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 361 Length adjustment: 29 Effective length of query: 295 Effective length of database: 332 Effective search space: 97940 Effective search space used: 97940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory