Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_110804036.1 C8J30_RS01990 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_003217355.1:WP_110804036.1 Length = 361 Score = 303 bits (775), Expect = 6e-87 Identities = 177/360 (49%), Positives = 227/360 (63%), Gaps = 24/360 (6%) Query: 1 MAGIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRI 60 MA +K+ ++ K YG L DINLDI+ GE +VFVGPSGCGKSTLLR +AGLE +S+G + Sbjct: 1 MADLKLTRVGKSYGEVDVLRDINLDIKAGELIVFVGPSGCGKSTLLRMIAGLERISAGEL 60 Query: 61 EIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARV 120 I G V + PA R +AMVFQSYALYPHMTVR+NMEF +K+ + + AAR+ Sbjct: 61 RIDGVRVNDMPPAQRGIAMVFQSYALYPHMTVRQNMEFALKIAKKTRQDIDKAVENAARI 120 Query: 121 LQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLH 180 LQL YLDR P LSGGQRQRVAIGRAIV++P V+LFDEPLSNLDA LRV R+E+ L Sbjct: 121 LQLTPYLDRLPKALSGGQRQRVAIGRAIVRDPKVYLFDEPLSNLDAALRVATRIEIAQLK 180 Query: 181 KQL-GATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAM 239 + + TMIYVTHDQVEAMT+A +IVVL I QVG+P++LY KP + FVA+FIGSP M Sbjct: 181 EAMPERTMIYVTHDQVEAMTLASRIVVLANKGIAQVGTPLELYEKPETEFVAQFIGSPQM 240 Query: 240 N--------------VFSSDVGLQDISLDASAA------FVGCRPEHIEIVPDGDGHIAA 279 N V D G ++ S A +G RPE + ++ +G G Sbjct: 241 NLLPGVIRETGAVTVVALDDGGTARSTVPTSPADLGLRVNIGVRPEDLTVITEG-GLFTG 299 Query: 280 TVHVKERLGGESLLYLGLK-GGGQIVARVGGDDETKVGAAVSLRFSRHRLHQFDEAGRAI 338 V + E LG +LLY K G +VA++ G + V L + ++H F AGR++ Sbjct: 300 VVEIVEALGEVTLLYFAAKPGEPHMVAKLPGIHAGLRHSTVGLTAAPEKVHLF-HAGRSL 358 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 361 Length adjustment: 29 Effective length of query: 309 Effective length of database: 332 Effective search space: 102588 Effective search space used: 102588 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory