Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_110805339.1 C8J30_RS08100 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_003217355.1:WP_110805339.1 Length = 348 Score = 245 bits (626), Expect = 1e-69 Identities = 132/312 (42%), Positives = 202/312 (64%), Gaps = 13/312 (4%) Query: 1 MAGIKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRI 60 M+ + + + K +GT + + D NL +E GEF+ +GPSGCGK+T+LR +AG E +SG I Sbjct: 1 MSYLSLTHLEKSFGTLRVVKDFNLTVEKGEFISLLGPSGCGKTTVLRMVAGFELPTSGAI 60 Query: 61 EIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARV 120 I G++VT ++P R++ MVFQ+YAL+P++TV +N+ FG+KV G +R+ E + Sbjct: 61 TIAGKEVTDLKPNQRNIGMVFQAYALFPNLTVAQNVGFGLKVKGTPKAAIDKRVEEMLSL 120 Query: 121 LQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLH 180 + L D +R P QLSGGQ+QRVA+ RA+ PSV L DEPLS LDAK+RV +R E+ + Sbjct: 121 IGLPDLGNRYPFQLSGGQQQRVALARALAPKPSVLLLDEPLSALDAKVRVSLRNEIRAIQ 180 Query: 181 KQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGS-PAM 239 ++LG T I+VTHDQ EA++M+D++VV++ G +QVG+P D+Y++P++RFVA F+G+ + Sbjct: 181 RELGITTIFVTHDQEEALSMSDRVVVMHEGIADQVGTPFDIYNRPSTRFVASFVGTLNTL 240 Query: 240 NVFSSD-------VGLQDI----SLDASAAFVGCRPEHIEI-VPDGDGHIAATVHVKERL 287 NV D +G +I SL + +G RPE + + + D ++AT+ + L Sbjct: 241 NVQVLDAANGRVKLGATEIALGRSLPSGPVTLGLRPEAVTLGQGNHDTRLSATIREVDFL 300 Query: 288 GGESLLYLGLKG 299 G L L G Sbjct: 301 GSVIRLRADLAG 312 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 348 Length adjustment: 29 Effective length of query: 309 Effective length of database: 319 Effective search space: 98571 Effective search space used: 98571 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory