Align D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_110805879.1 C8J30_RS10885 sugar ABC transporter ATP-binding protein
Query= uniprot:A0A1N7TX47 (495 letters) >NCBI__GCF_003217355.1:WP_110805879.1 Length = 511 Score = 341 bits (874), Expect = 4e-98 Identities = 191/481 (39%), Positives = 282/481 (58%), Gaps = 12/481 (2%) Query: 4 PLLLQAEHVAKAYAGVPALRDGRLSLRAGSVHALCGGNGAGKSTFLSILMGITQRDAGSI 63 P+ L K Y G AL+ LR G+V+ L G NGAGKST + ++ G+ G+I Sbjct: 6 PIGLSIRGGVKVYPGTRALKGVDFDLRMGAVNVLVGENGAGKSTLMKLIAGVEDMTEGTI 65 Query: 64 LLNGAPVQFNRPSEALAAGIAMITQELEPIPYMTVAENIWLGREPRRAGCIVDNKALNRR 123 ++G ++F ++A+AAGI ++ QEL P ++VAENI++G E R G +D +A Sbjct: 66 TMDGREMRFRTKADAVAAGIGIVFQELNLFPNLSVAENIFIGHETTRGGIDIDIEAHREA 125 Query: 124 TRELLDSLEFDVDATSPMHRLSVAQIQLVEIAKAFSHDCQVMIMDEPTSAIGEHEAQTLF 183 TR+L++ LE ++ +P+ L + Q Q+VEIAKA + + +++I+DEPTSA+ E + LF Sbjct: 126 TRQLMERLEQNIHPDTPLGNLRIGQQQIVEIAKALAQNARILILDEPTSALSAAEVEVLF 185 Query: 184 KAIRRLTAQGAGIVYVSHRLSELAQIADDYSIFRDGAFVESGRMADIDRDHLVRGIVGQE 243 + I LTAQG GIVY+SHRL EL ++ D ++ RDG + M +D +V+ ++G Sbjct: 186 RVIDELTAQGVGIVYISHRLEELIRVGDYITVLRDGVITGARSMEGVDIPWIVKAMIGSS 245 Query: 244 LTRIDHKVGRECAANTCLQV-----DNLSRAG---EFHDISLQLRQGEILGIYGLMGSGR 295 + GR AN ++ L RAG +SL +R GEI+G+YGLMG+GR Sbjct: 246 ----SKEYGRSEVANFGPEIFRAEDITLPRAGGGFTVDHVSLSIRSGEIVGLYGLMGAGR 301 Query: 296 SEFLNCIYGLTVADSGSVTLQGKPMPIGLPKATINAGMSLVTEDRKDSGLVLTGSILSNI 355 SEFL C+ G ++GKP+ I G++L+ EDRK GL+ SI N+ Sbjct: 302 SEFLECVMAQHPHSGGKFWVEGKPLTERDVPGRIARGIALIPEDRKRDGLIQIMSIRENL 361 Query: 356 ALSAYKRLSSWSLINARKETQLAEDMVKRLQIKTTSLELPVASMSGGNQQKVVLAKCLST 415 LS+ + ++ +KE + A + +KRL IK S E PV+S+SGGNQQKVV+ K L T Sbjct: 362 TLSSLPSFTKLFHLDLKKEAKTAVEFIKRLTIKVASPENPVSSLSGGNQQKVVIGKALMT 421 Query: 416 EPVCLLCDEPTRGIDEGAKQEIYHLLDQFVRGGGAAIVVSSEAPELLHLSDRIAVFKGGR 475 P LL DEP+RGID GAK E++ + + G + V+S+ E+L LSDRI V GR Sbjct: 422 GPKVLLMDEPSRGIDIGAKAEVFRTMRRLAAEGLGILFVTSDLDEVLALSDRIIVMAQGR 481 Query: 476 L 476 + Sbjct: 482 V 482 Lambda K H 0.319 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 605 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 511 Length adjustment: 34 Effective length of query: 461 Effective length of database: 477 Effective search space: 219897 Effective search space used: 219897 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory