Align D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_110806491.1 C8J30_RS14105 sugar ABC transporter ATP-binding protein
Query= uniprot:A0A1N7TX47 (495 letters) >NCBI__GCF_003217355.1:WP_110806491.1 Length = 513 Score = 368 bits (945), Expect = e-106 Identities = 201/493 (40%), Positives = 312/493 (63%), Gaps = 5/493 (1%) Query: 6 LLQAEHVAKAYAGVPALRDGRLSLRAGSVHALCGGNGAGKSTFLSILMGITQRDAGSILL 65 +L+ + V K + GV AL + +L +R GSVHAL G NGAGKST + I+ G+ D G + Sbjct: 22 ILEVDGVRKEFPGVVALDNVQLKIRPGSVHALMGENGAGKSTLMKIIAGVYNPDRGEVRF 81 Query: 66 NGAPVQFNRPSEALAAGIAMITQELEPIPYMTVAENIWLGREPRRAGCIVDNKALNRRTR 125 G + P +AL GIAMI QEL + MTVAEN+W+ REP+ A ++D+ + T Sbjct: 82 AGEKLVIRTPIDALNCGIAMIHQELNLMNTMTVAENVWIRREPKGAFGLIDHARMGTMTA 141 Query: 126 ELLDSLEFDVDATSPMHRLSVAQIQLVEIAKAFSHDCQVMIMDEPTSAIGEHEAQTLFKA 185 EL SL +D + + L+VAQ Q++EIAKA S++ V+IMDEPTSAI E E + LF Sbjct: 142 ELFASLNIHLDPLAIVGDLTVAQKQMIEIAKAVSYNSDVLIMDEPTSAITETEVEHLFAI 201 Query: 186 IRRLTAQGAGIVYVSHRLSELAQIADDYSIFRDGAFVESGRMADIDRDHLVRGIVGQELT 245 IR L A+G GIVY++H+++E+ +IAD+ ++FRDG ++ + +++ RD ++R +VG+E+T Sbjct: 202 IRDLRARGVGIVYITHKMNEIFEIADELTVFRDGKYISTVPASEVTRDDIIRMMVGREIT 261 Query: 246 RIDHKVGREC-AANTCLQVDNLSRAGEFHDISLQLRQGEILGIYGLMGSGRSEFLNCIYG 304 + KV +C + L V NLS G F +IS +LR+GEILG+ GL+GSGRS ++G Sbjct: 262 EMFPKV--DCPIGDVILDVQNLSLPGVFDNISFKLRKGEILGVAGLVGSGRSNVAEALFG 319 Query: 305 LTVADSGSVTLQGKPMPIGLPKATINAGMSLVTEDRKDSGLVLTGSILSN--IALSAYKR 362 + A++G + + G+ + + P+ ++ G++ +TEDRK++G L L N +AL + Sbjct: 320 VHPAETGDIWIDGEHVVMTSPQVAMDHGLAFLTEDRKETGCFLVLDCLENMQMALITRDK 379 Query: 363 LSSWSLINARKETQLAEDMVKRLQIKTTSLELPVASMSGGNQQKVVLAKCLSTEPVCLLC 422 ++ + + T+L ++ +L++KT +L V ++SGGNQQK+++A+ L T P L+ Sbjct: 380 VNGAGFVQQAEVTRLVQEYSAKLRVKTPNLAERVENLSGGNQQKLLIARWLLTNPRILIL 439 Query: 423 DEPTRGIDEGAKQEIYHLLDQFVRGGGAAIVVSSEAPELLHLSDRIAVFKGGRLVTISTD 482 DEPTRGID GAK EI+ L+ G A +++SSE PE+L +SDRI V GR+ Sbjct: 440 DEPTRGIDVGAKSEIHRLITALAGQGVAVLMISSELPEVLGMSDRIMVMHEGRVSGFLDR 499 Query: 483 TALSQEALLRLAS 495 +Q ++ LA+ Sbjct: 500 AEATQVRVMELAA 512 Lambda K H 0.319 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 609 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 513 Length adjustment: 34 Effective length of query: 461 Effective length of database: 479 Effective search space: 220819 Effective search space used: 220819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory