Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate WP_110806514.1 C8J30_RS14100 ABC transporter permease
Query= TCDB::G4FGN4 (313 letters) >NCBI__GCF_003217355.1:WP_110806514.1 Length = 339 Score = 196 bits (498), Expect = 7e-55 Identities = 116/319 (36%), Positives = 173/319 (54%), Gaps = 22/319 (6%) Query: 10 EAGIFLILIAIVVFLGVTTREF------LTVENIFTVILNVSFIAIMSFGMTMVIITSGI 63 E I +L+ I + + F ++++ + +IL VS I I+S G+T VII GI Sbjct: 21 EVNILFVLVGIALVFEILGWIFQGQSFLMSIDRLKIMILQVSVIGIISVGVTQVIIAGGI 80 Query: 64 DLSVGSILGAASV-----------VMGLLMDEKGLSPFLSVVIGLAVGVGFGLANGLLIT 112 DLS GS++GA ++ + D L + + +GL G GL NG LI Sbjct: 81 DLSSGSVVGAVAMFAMSFAQVSTYARAVYPDLTDLPAIVPIALGLMAGALVGLINGALIA 140 Query: 113 KARLAPFISTLGMLSVGRGLAYVMSGGWPISPFPESFTVHGQGMVGPVPVPVIYMAVIGV 172 A++ PFI+TLG + RG A + G PIS + F G+GM+ PV + Sbjct: 141 YAKIPPFIATLGTMVTARGFAKWYTKGQPISFPTDDFAFIGKGMM-----PVAIFLAVAA 195 Query: 173 IAHIFLKYTVTGRRIYAIGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGV 232 I H+ +KYT G+ YAIG N +A+++ GI + LI VY + LAA AG ++ A Sbjct: 196 IFHVAMKYTRYGKFTYAIGANQQAARVSGINVEHHLIKVYVVAATLAALAGMVVAARGQT 255 Query: 233 AQPNAGQGYELDVIAATVIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQV 292 AQ G YELD IA VIGG SL+GG G+ILG +G VI GV+ +G L + +++Q++ Sbjct: 256 AQAGMGLAYELDAIAMAVIGGVSLTGGRGSILGTMIGMVIFGVIISGFTFLRLDAYYQEM 315 Query: 293 VIGIVIIIAIAIDQIRRAK 311 + G++I+ A+ D R+ K Sbjct: 316 IKGVIIVAAVVADVYRQKK 334 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 339 Length adjustment: 28 Effective length of query: 285 Effective length of database: 311 Effective search space: 88635 Effective search space used: 88635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory