GapMind for catabolism of small carbon sources

 

Protein WP_111390831.1 in Algoriphagus aquaeductus T4

Annotation: NCBI__GCF_003253485.1:WP_111390831.1

Length: 243 amino acids

Source: GCF_003253485.1 in NCBI

Candidate for 50 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA lo spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 43% 56% 178.7 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-cellobiose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 59% 166.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 59% 166.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-glucose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 59% 166.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
lactose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 59% 166.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 59% 166.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
sucrose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 59% 166.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
trehalose catabolism gtsD lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 38% 59% 166.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 37% 59% 163.7 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-mannitol catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) 38% 61% 162.9 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 41% 63% 162.9 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 41% 52% 162.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 57% 160.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 57% 160.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 38% 55% 159.5 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 39% 52% 159.5 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 40% 58% 156.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 37% 61% 155.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 38% 60% 154.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 38% 60% 154.8 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 37% 59% 152.1 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 37% 60% 152.1 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 36% 61% 151.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 35% 63% 151.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 35% 68% 151.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 55% 149.1 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 39% 52% 149.1 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 56% 149.1 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
sucrose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 36% 56% 149.1 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 35% 70% 147.5 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 69% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 69% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 69% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 69% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 69% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 69% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 69% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 69% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 33% 69% 144.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 36% 56% 144.1 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 57% 141.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 57% 141.4 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 42% 67% 137.5 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 30% 61% 115.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-cellobiose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 88% 103.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-glucose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 88% 103.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
lactose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 88% 103.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
D-maltose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 88% 103.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
sucrose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 88% 103.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0
trehalose catabolism mglA lo glucose transporter, ATPase component (characterized) 31% 88% 103.2 CP4-6 prophage; ABC transporter ATP-binding protein AfuC 38% 188.0

Sequence Analysis Tools

View WP_111390831.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MFLEIKQLSKSFQNDLIVDRLSLSLDQHRTLSILGKSGCGKTTLLKLIAGLETADQGSIR
VNGEDMSGKTPAERKIVYLYQEDLLFPHLSVRGNIGFGLKLQKIPASDIKEQVDLMIQRL
ELQGQGDKMPHQLSGGQRQRVSFGRAIITNPRLLLLDEPFGSLDVGTRQRMQELFKELTA
LYGITSLFVTHDLKEAILMGDDIGLMKKGSLQVYPDKQDFLLDPGTGVRSEIEFWESLLK
PNY

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory