Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_111392030.1 CLV31_RS05425 zinc-dependent alcohol dehydrogenase family protein
Query= BRENDA::D4GSN2 (353 letters) >NCBI__GCF_003253485.1:WP_111392030.1 Length = 346 Score = 260 bits (664), Expect = 4e-74 Identities = 142/349 (40%), Positives = 204/349 (58%), Gaps = 10/349 (2%) Query: 1 MRAAVLREHGEPLDVTEVPDPTCDADGVVVEVEACGICRSDWHSWMGHGEWADDAVPSGQ 60 M+A ++ E +T+VPDP GVV+EV+A G+CRSDWH WMGH D + Sbjct: 1 MKAILVESFQEKPIITQVPDPQVPDYGVVLEVKATGLCRSDWHGWMGH----DSDIRLPH 56 Query: 61 ILGHEPAGRVVEAGDRVETIREGDRVALPFNLACGSCGYCQTGHGNVCTGDHPHALGFEP 120 + GHE AG + E G V+ + GDRV +PF ACG+C CQ+G+ +C D GF Sbjct: 57 VPGHEFAGVIREVGKGVKNWKAGDRVTVPFVCACGTCPTCQSGNQQIC--DDQFQPGF-- 112 Query: 121 AAQGAFAELVHLPSADYNAIQLPEDVLPTDVAALGCRFMTAYNALDARAGLRAGQWVAVH 180 G+FAE V + A+ N ++LP+ V A+LGCRF T++ + A+ + GQWVAVH Sbjct: 113 THWGSFAEYVAVHRAEANLVRLPDSVSFEAAASLGCRFATSFRGVVAQGKVTGGQWVAVH 172 Query: 181 GCGGVGLSTIQVANVLGARVVAVDVRESALDAAADLGADAVVDGSAE-DPVDAIRGLTDG 239 GCGGVGLS I +A LGA+V+AVD+ E L A GAD +++G D +AI LT G Sbjct: 173 GCGGVGLSAIMIAAALGAQVIAVDISEEKLALAKAAGADILLNGKINPDIPEAILELTKG 232 Query: 240 GAHVSLDALGVAETCRNSVRSVRPRGSHVQVGLTTEAEKGNVSLPTDWMTRHEVSFLGAR 299 GAHVS+DALG TC NS+ +R RG H+Q+GL ++ N +P + E+ LG+ Sbjct: 233 GAHVSIDALGSKITCYNSIACLRKRGKHIQIGLMA-GDQTNPQVPMHLVIAQELELLGSH 291 Query: 300 GMPPTNADDLLSLLASDAVDPGSLVTKTVSLDEVPERLAAMTDYDTVGV 348 GM +++ ++ + P +L+ + + LDE E L +M + G+ Sbjct: 292 GMQAHAYPEMMQMILQGKIAPQTLIGRRIGLDEAVEALTSMDRFQENGM 340 Lambda K H 0.317 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 346 Length adjustment: 29 Effective length of query: 324 Effective length of database: 317 Effective search space: 102708 Effective search space used: 102708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory