Align Short-chain dehydrogenase (characterized, see rationale)
to candidate WP_111392913.1 CLV31_RS10820 glucose 1-dehydrogenase
Query= uniprot:A0A2E7P8M8 (258 letters) >NCBI__GCF_003253485.1:WP_111392913.1 Length = 255 Score = 105 bits (262), Expect = 9e-28 Identities = 84/254 (33%), Positives = 125/254 (49%), Gaps = 13/254 (5%) Query: 4 NLQDKVVIVTGGASGIGGAISLQLAAEGAIPVVFARSEPDPQFWA---RLTGLQPRAALF 60 +L+ KV ++TG + GIG +I+ AA GA V+ +R + A R G Sbjct: 8 SLEGKVALITGASKGIGFSIAEIFAAAGAKVVISSRKQDALDGMAEKLRSKGYVGSGIAC 67 Query: 61 QLELQDEARCGEAVAETVRRFGRLDGLVNNAGVNDSVGL--DAGRNEFVASLERNLIHYY 118 + DE V +TV +G +D LVNNA N G + F + N+ + Sbjct: 68 NVGNMDELPA--LVEKTVALYGTIDILVNNAATNPVFGPVHETSLEAFDKIMNVNVKAAF 125 Query: 119 VMAHYCVPHLKATRGA-ILNVSSKTALTGQGNTSGYCASKGAQLSLTREWAAALRDDGVR 177 + C PHL+ + GA ++N+SS ++ + Y SK A +SLT+ +A D +R Sbjct: 126 ELCRLCYPHLRKSSGASVINISSIGGISPEHGLGIYSVSKAALISLTKVFAKEWGDSKIR 185 Query: 178 VNALIPAEVMTPLYEKWIATFENPQEKLDAITSKIPLGKRFTTSEEMADMAVFLLSGRSS 237 VNA+ P + T E A + N EK+ ++ K KR TSEE+ MA+FL S SS Sbjct: 186 VNAICPGLIQTKFSE---ALWTN--EKIMSMIMKQLAIKRAGTSEEIGAMALFLASSASS 240 Query: 238 HTTGQWVFVDGGYT 251 +TTG DGG+T Sbjct: 241 YTTGGVFTADGGFT 254 Lambda K H 0.318 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 120 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 255 Length adjustment: 24 Effective length of query: 234 Effective length of database: 231 Effective search space: 54054 Effective search space used: 54054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory