Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_111392201.1 CLV31_RS07185 glucose 1-dehydrogenase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2119 (272 letters) >NCBI__GCF_003253485.1:WP_111392201.1 Length = 252 Score = 171 bits (432), Expect = 2e-47 Identities = 93/250 (37%), Positives = 145/250 (58%), Gaps = 4/250 (1%) Query: 17 ERLKNKVVLLTGAAQGIGEAIVATFASQQARLIISDIQGEKVEKVAAHWRDQGADVVAIK 76 ++L+NKV ++TGAA G+G+AI FA + A++I+SD+ G E+VA R G + +K Sbjct: 2 KKLENKVAIVTGAASGMGKAISLLFAQEGAKVIVSDLTGADAEEVADQIRHSGGHALGLK 61 Query: 77 ADVSRQQDLHAMARLAIDLHGRIDVLVNCAGVNVFRDPLE-MTEEDWRRCFAIDLDGAWY 135 DVS ++ + M AI G +D+LVN AG+ PLE +T++ W + A++++G +Y Sbjct: 62 CDVSDEEQVKRMVHAAIHEFGGLDILVNNAGIMDNFTPLEKVTDKLWEKVMAVNVNGPFY 121 Query: 136 GCKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRV 195 + + QM++QG G IINIAS Y +KH L+G+++ +G YA KG+R Sbjct: 122 ASRLAITQMLKQGKGVIINIASVGGVSGARAGLAYTTSKHALVGMSKNIGFMYAKKGIRC 181 Query: 196 NAIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPFI 255 N IAPG + T + D DP + R+G+P E+A A+FLASD++ F+ Sbjct: 182 NVIAPGGVNTNIMKD---AQPDPDGAVLCSSGAGSMSRMGEPEEIAKVALFLASDDSSFV 238 Query: 256 NASCITIDGG 265 N + DGG Sbjct: 239 NGEVLVADGG 248 Lambda K H 0.322 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 252 Length adjustment: 25 Effective length of query: 247 Effective length of database: 227 Effective search space: 56069 Effective search space used: 56069 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory