Align Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (characterized)
to candidate WP_111393797.1 CLV31_RS14820 acyl-CoA dehydrogenase
Query= reanno::psRCH2:GFF1051 (387 letters) >NCBI__GCF_003253485.1:WP_111393797.1 Length = 379 Score = 298 bits (763), Expect = 2e-85 Identities = 156/375 (41%), Positives = 231/375 (61%) Query: 6 LNFALGETIDMLREQVQAFVAAEIAPRAEAIDQENLFPADMWRKFGEMGLLGVTVSEEYG 65 +NF L E ++E + F +E+ P D E FP + +K G++G LG+ V +Y Sbjct: 1 MNFQLTEEHLAVQEAAREFAQSELLPGVIDRDSEAKFPHEQIKKMGDLGFLGMMVDPKYN 60 Query: 66 GAGLGYLAHVVAMEEISRGSASVALSYGAHSNLCVNQINRNGNPEQKARYLPKLISGEHV 125 G G+ +++V+AMEE+S+ AS ++S +++L + + G+ EQK +YL +L +GE + Sbjct: 61 GGGMDTISYVIAMEELSKIDASASVSMSVNNSLVCWGLEKYGSEEQKQKYLTRLATGEIL 120 Query: 126 GALAMSEPNAGSDVVSMKLRAEKRGDRYVLNGSKTWITNGPDANTYVIYAKTDLDKGAHG 185 GA +SEP AGSD S + AE GD YVLNG+K WITNG A+ Y++ A+TD KG G Sbjct: 121 GAFCLSEPEAGSDATSQRTSAEWNGDHYVLNGTKNWITNGSTASVYLVIAQTDASKGHKG 180 Query: 186 ITAFIVERDWKGFSRGNKFDKLGMRGSNTCELFFDDVEVPQENVLGAENGGVKVLMSGLD 245 I+ F+VE+ W+GF G K DKLG+RGS+T L F DV+VP EN +G E G M L+ Sbjct: 181 ISVFLVEKGWEGFVIGKKEDKLGIRGSDTHSLMFTDVKVPAENRIGEEGFGFTFAMETLN 240 Query: 246 YERVVLAGGPTGIMQSCLDVVVPYIHDRKQFGQSIGEFQFIQGKVADMYTQLNASRAYLY 305 R+ +A GI ++ + Y +RK FG+ I + Q IQ K+ADM TQ+ A+R +Y Sbjct: 241 GGRIGIAAQALGIASGAYELALAYSKERKAFGKPISQHQAIQFKLADMATQIEAARLLVY 300 Query: 306 AVAQACDRGETTRKDAAGVILYTAENATQMALQAIQILGGNGYINEFPTGRLLRDAKLYE 365 A D+GE +A LY +E A + ++A+Q+ GG GY+ E+ RL+RDAK+ + Sbjct: 301 KAAWLKDQGEDYAHASAMAKLYASEVAMNVTVEAVQVHGGYGYVKEYHVERLMRDAKITQ 360 Query: 366 IGAGTSEIRRMLIGR 380 I GTSEI+R++I R Sbjct: 361 IYEGTSEIQRIVISR 375 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 379 Length adjustment: 30 Effective length of query: 357 Effective length of database: 349 Effective search space: 124593 Effective search space used: 124593 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory