Align sorbitol-6-phosphate dehydrogenase subunit (EC 1.1.1.140) (characterized)
to candidate WP_111392034.1 CLV31_RS05620 SDR family oxidoreductase
Query= metacyc::MONOMER-13092 (266 letters) >NCBI__GCF_003253485.1:WP_111392034.1 Length = 290 Score = 99.0 bits (245), Expect = 1e-25 Identities = 81/269 (30%), Positives = 125/269 (46%), Gaps = 31/269 (11%) Query: 6 NIAGKTVIVTGASSGIGKAIVDELLSL--KVKVANFDLTDNGEKHENLLFQK-------- 55 ++ GK +++TG +G+GKA+ + L L + + + L E ++ QK Sbjct: 12 SLKGKNILITGGGTGLGKAMGEYFLELGANLVITSRKLDVLQETANEMMSQKGGKVLPLA 71 Query: 56 VDVTSREQVEASVAAVVEHFGTVDAVVNNAGINIPRLLVDPKDPHGQYELDDATFEKITM 115 DV QVEA +A + FG + V+NNA N + P + L F + Sbjct: 72 CDVREISQVEAMWSAAIAEFGQIHVVLNNAAGNF----ISPTE-----RLSVNAFNTVLD 122 Query: 116 INQKGLYLVSQAVGRLLVAKKK-GVIINMASEAGLEGSEGQSAYAGTKAAVYSYTRSWAK 174 I KG V+ G+ +A+K+ GV +N+ + GS A KA V + TRS A Sbjct: 123 IVLKGTSQVTLTAGKFWIAQKQPGVFLNIVTTYAWTGSGYVVPSAAAKAGVLALTRSLAV 182 Query: 175 ELGKYGVRVVGIAPGIMEATGLRTLAYEEALGYTRGKTVEEIRAGYASTTTTPLGRSGKL 234 E KYG+R IAPG G A+ L G V++ + P+GR G+ Sbjct: 183 EWAKYGIRSNAIAPGPFPTEG----AWSRLL---PGDLVKK----FDPAKKVPVGRVGEH 231 Query: 235 SEVADLVAYYISDRSSYITGITTNVAGGK 263 E+A+L AY +SD S+Y+ G + GG+ Sbjct: 232 QELANLAAYMVSDFSAYVNGEVITIDGGE 260 Lambda K H 0.313 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 290 Length adjustment: 25 Effective length of query: 241 Effective length of database: 265 Effective search space: 63865 Effective search space used: 63865 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory