Align L-iditol 2-dehydrogenase; EC 1.1.1.14 (characterized)
to candidate WP_111392041.1 CLV31_RS06290 zinc-binding alcohol dehydrogenase family protein
Query= CharProtDB::CH_000596 (353 letters) >NCBI__GCF_003253485.1:WP_111392041.1 Length = 342 Score = 155 bits (393), Expect = 1e-42 Identities = 106/345 (30%), Positives = 175/345 (50%), Gaps = 12/345 (3%) Query: 9 MKAAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVEK-PFI 67 MKA + + ++ + P EVL++V VG CG DL NG G + +++ P + Sbjct: 1 MKAFFLTEIGKTEVREIEKPSPKSGEVLLEVGKVGFCGGDL----NGFKGLFPLQEYPNV 56 Query: 68 LGHECAGEIAAVGSSVDQ-FKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFLATPPVD 126 LGHE I G+ V + ++G RV + P + CG C AC++GR N C + + Sbjct: 57 LGHEVGATIVEKGNEVPETIQIGTRVTLYPYLACGTCVACRKGRPNACKTNKTMGVRR-P 115 Query: 127 GAFVQYIKMRQDFVFLIPDSLSYEEAALIEPFSVGIHAAARTKLQPGSTIAIMGMGPVGL 186 GA +YI VF D LS E AL+EP +VG HAA+R ++ +A++G G VGL Sbjct: 116 GAMTRYITAPWQDVFP-SDKLSLSELALVEPLTVGFHAASRGRVSYEDRVAVIGCGIVGL 174 Query: 187 MAVAAAKAFGAGTIIVTDLEPLRLEAAKKMGATHIINIREQDALEEIKTITNDRGVDVAW 246 AVA+A GA +I DL+ +L+ AK++G H IN ++D ++ ITN G +V Sbjct: 175 GAVASAVNKGA-QVIAVDLDDSKLDIAKQIGVAHTINPSKEDLHTRLQEITNGDGPNVII 233 Query: 247 ETAGNPAALQSALASVRRGGKLAIVGLPSQNEIPLNVPFIADNEIDIYGIFRYA--NTYP 304 E G+P +SA+ V G++ +G ++ + N EI+I G +P Sbjct: 234 EAVGSPQTYRSAVEEVAFLGRVVCIGY-AKAPVEFNTSLFVQKEIEILGSRNCVGKTDFP 292 Query: 305 KGIEFLASGIVDTKHLVTDQYSLEQTQDAMERALQFKNECLKVMV 349 + I +L +G +++ +++ + M+ + +K+M+ Sbjct: 293 EVIAYLEAGKFPVDAVISKVIPIDEAPETMDAWAKNPQGIIKIML 337 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 342 Length adjustment: 29 Effective length of query: 324 Effective length of database: 313 Effective search space: 101412 Effective search space used: 101412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory