Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate WP_111392201.1 CLV31_RS07185 glucose 1-dehydrogenase
Query= BRENDA::Q8GR61 (262 letters) >NCBI__GCF_003253485.1:WP_111392201.1 Length = 252 Score = 142 bits (357), Expect = 9e-39 Identities = 87/260 (33%), Positives = 123/260 (47%), Gaps = 13/260 (5%) Query: 3 KKFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREKGVEARSYV 62 KK KV +VTGA +G A +L A+EG + + D+ E+ +R G A Sbjct: 2 KKLENKVAIVTGAASGMGKAISLLFAQEGAKVIVSDLTGADAEEVADQIRHSGGHALGLK 61 Query: 63 CDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFH 122 CDV+ EE V V + + +FG +D L NNAG F P++ + +V+ +NV G F+ Sbjct: 62 CDVSDEEQVKRMVHAAIHEFGGLDILVNNAGIMDNFTPLEKVTDKLWEKVMAVNVNGPFY 121 Query: 123 VLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRV 182 + QM+ Q G I+N AS+ GV G AY TSK A++ +++ A IR Sbjct: 122 ASRLAITQMLKQGKGVIINIASVGGVSGARAGLAYTTSKHALVGMSKNIGFMYAKKGIRC 181 Query: 183 NAISPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVVA 242 N I+PG + M + Q DP G+ M R G+ EI V Sbjct: 182 NVIAPGGVNTNIMKDAQ-------------PDPDGAVLCSSGAGSMSRMGEPEEIAKVAL 228 Query: 243 FLLGDDSSFMTGVNLPIAGG 262 FL DDSSF+ G L GG Sbjct: 229 FLASDDSSFVNGEVLVADGG 248 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 252 Length adjustment: 24 Effective length of query: 238 Effective length of database: 228 Effective search space: 54264 Effective search space used: 54264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory