Protein WP_111606157.1 in Marinomonas arctica 328
Annotation: NCBI__GCF_003259225.1:WP_111606157.1
Length: 359 amino acids
Source: GCF_003259225.1 in NCBI
Candidate for 38 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| D-maltose catabolism | malK | med | Maltose-transporting ATPase (EC 3.6.3.19) (characterized) | 55% | 97% | 391 | MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK | 53% | 390.6 |
| D-mannitol catabolism | mtlK | med | MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) | 53% | 98% | 390.6 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-sorbitol (glucitol) catabolism | mtlK | med | MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) | 53% | 98% | 390.6 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-maltose catabolism | malK1 | med | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 53% | 98% | 355.1 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| trehalose catabolism | thuK | med | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 53% | 98% | 355.1 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-maltose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 53% | 99% | 351.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-maltose catabolism | thuK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 53% | 99% | 351.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| sucrose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 53% | 99% | 351.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| trehalose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 53% | 99% | 351.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| xylitol catabolism | Dshi_0546 | med | ABC transporter for Xylitol, ATPase component (characterized) | 51% | 100% | 350.9 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| L-fucose catabolism | SM_b21106 | med | ABC transporter for L-Fucose, ATPase component (characterized) | 52% | 97% | 350.5 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| lactose catabolism | lacK | med | ABC transporter for Lactose, ATPase component (characterized) | 52% | 99% | 350.1 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-cellobiose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 52% | 95% | 349.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-glucose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 52% | 95% | 349.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| lactose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 52% | 95% | 349.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-maltose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 52% | 95% | 349.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-mannose catabolism | TT_C0211 | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 52% | 95% | 349.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| sucrose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 52% | 95% | 349.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| trehalose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 52% | 95% | 349.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| N-acetyl-D-glucosamine catabolism | SMc02869 | med | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 54% | 87% | 337.8 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-glucosamine (chitosamine) catabolism | SMc02869 | med | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 54% | 87% | 337.8 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-maltose catabolism | malK_Aa | med | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 48% | 94% | 330.9 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-xylose catabolism | gtsD | med | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 48% | 92% | 327.4 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-cellobiose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 51% | 96% | 325.9 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-glucose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 51% | 96% | 325.9 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| lactose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 51% | 96% | 325.9 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-maltose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 51% | 96% | 325.9 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| sucrose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 51% | 96% | 325.9 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| trehalose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 51% | 96% | 325.9 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-galactose catabolism | PfGW456L13_1897 | med | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 46% | 94% | 322.4 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-maltose catabolism | malK_Bb | med | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 47% | 98% | 319.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-cellobiose catabolism | msiK | med | MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) | 47% | 98% | 312 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| D-glucosamine (chitosamine) catabolism | SM_b21216 | med | ABC transporter for D-Glucosamine, ATPase component (characterized) | 44% | 97% | 299.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| xylitol catabolism | HSERO_RS17020 | med | ABC-type sugar transport system, ATPase component protein (characterized, see rationale) | 46% | 89% | 298.5 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| glycerol catabolism | glpT | lo | GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) | 35% | 98% | 222.2 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| L-proline catabolism | opuBA | lo | BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) | 39% | 86% | 188 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| glycerol catabolism | glpS | lo | ABC transporter for Glycerol, ATPase component 1 (characterized) | 34% | 95% | 187.6 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
| L-proline catabolism | proV | lo | Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) | 39% | 57% | 176.8 | Maltose-transporting ATPase (EC 3.6.3.19) | 55% | 391.0 |
Sequence Analysis Tools
View WP_111606157.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MADVTLHKLVKRYDKTDIIKGVDIDIKDGEFTVFVGPSGCGKSTLLRMIAGLEDITDGTL
SIDGKVVNHLQPKDRSIAMVFQSYAIFPHMTVRENMAFGLTIAGISKQEKDQQVNEAAKV
LQMEHLLERRPSQLSGGQRQRVAIGRAIVRNPKVFLFDEPLSNLDAALRMDMRMEIAKLH
KKLGATMIYVTHDQVEAMTLADKIVVLKGGEVQQIGSPMELFHHPANRFVAGFLGSPSMN
FVEAEVLAIDAQTITLGSSVLDPVVLPKPELALQLGQTVELGIRPQYLQPQHGDVKGSLH
GQVSLTERLGTETILDVSLTDGKKVIAAIGQDQLFQIGENIRLHFDPERAHVFVKSGDA
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory