Align PEB1C, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_111605872.1 DK187_RS03055 amino acid ABC transporter ATP-binding protein
Query= TCDB::A3ZI83 (242 letters) >NCBI__GCF_003259225.1:WP_111605872.1 Length = 259 Score = 275 bits (702), Expect = 8e-79 Identities = 141/243 (58%), Positives = 182/243 (74%), Gaps = 2/243 (0%) Query: 1 MIELKNVNKYYGTHHVLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVV 60 +IE +VNK+YG HVLKNIN S+K+GE++V+ GPSGSGKST RC+N LEE G + V Sbjct: 18 IIEFIDVNKWYGDFHVLKNINFSIKKGERIVVCGPSGSGKSTMTRCINRLEEHQKGIISV 77 Query: 61 NNLVLNHKNK-IEICRKYCAMVFQHFNLYPHMTVLQNLTLAPMKLQKKSKKEAEETAFKY 119 + + +N K IE RK MVFQHFNL+PH+++L+NLTLAP+ ++K KKEAEE A Y Sbjct: 78 DGVEMNDNLKNIEAIRKDVGMVFQHFNLFPHLSILENLTLAPIWVRKTPKKEAEEMAMHY 137 Query: 120 LKVVGLLDKANVYPATLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMK 179 L+ V + ++A YP LSGGQQQRVAIAR LC + +LFDEPTSALDPE I+EVLDVM Sbjct: 138 LERVKIANQALKYPGQLSGGQQQRVAIARGLCMQPRIMLFDEPTSALDPEMIKEVLDVMI 197 Query: 180 EISHQSNTTMVVVTHEMGFAKEVADRIIFMEDGAIVEENIPSEFFSNPKTERARLFLGKI 239 +++ + TMV VTHEMGFAK VADR++FM+ G IVE N P EFF NP+ +R ++FL +I Sbjct: 198 QLA-EEGMTMVCVTHEMGFAKTVADRVVFMDAGEIVEANKPHEFFDNPQHDRTQMFLSQI 256 Query: 240 LKN 242 L + Sbjct: 257 LNH 259 Lambda K H 0.317 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 259 Length adjustment: 24 Effective length of query: 218 Effective length of database: 235 Effective search space: 51230 Effective search space used: 51230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory