Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate WP_111605917.1 DK187_RS03290 carbohydrate ABC transporter permease
Query= reanno::Smeli:SMc04257 (305 letters) >NCBI__GCF_003259225.1:WP_111605917.1 Length = 294 Score = 304 bits (779), Expect = 1e-87 Identities = 141/288 (48%), Positives = 201/288 (69%) Query: 18 GRKPRRTLSRRNIIVYGTLIVVALYYLLPLYVMIVTSLKGMPEIRVGNIFAPPLEITFEP 77 GRK + +Y L+V A +YL+P VM++TSLK + EIR GN+ + P + F+ Sbjct: 7 GRKTSGVDKALRVALYTVLLVAAAFYLIPFIVMLITSLKDVEEIRTGNLLSLPAALNFDS 66 Query: 78 WVKAWAEACTGLNCDGLSRGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTI 137 W KAW+ ACTG +C G+S F NS +I +P+V IS + ++NGY ++ W+F+G+DLFF Sbjct: 67 WAKAWSSACTGSSCGGISPYFMNSFQIVLPAVAISTLVGAINGYVISLWKFRGSDLFFAA 126 Query: 138 LIVGAFIPYQVMIYPIVIVLREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELF 197 ++VG FIP+QV++ P+ L +G+ T +GL+ VH ++G+ TL FRN++ +P EL Sbjct: 127 MLVGCFIPFQVILLPMAQTLGWLGIANTASGLVFVHVVYGVAFTTLFFRNFYQSIPSELV 186 Query: 198 KAARVDGAGFWTIYFKIMLPMSLPIFVVAMILQVTGIWNDFLFGVVFTRPEYYPMTVQLN 257 KAAR+DGAGF+TI+++I+LP+S PI VV +I Q T IWNDFLFGV F+ + P+TV LN Sbjct: 187 KAARLDGAGFFTIFYRIILPVSTPIIVVTVIWQFTQIWNDFLFGVAFSGFDTQPVTVALN 246 Query: 258 NIVNSVQGVKEYNVNMAATILTGLVPLTVYFVSGRLFVRGIAAGAVKG 305 N+VN+ G KEYNV+MAA I+ L L VY +G+ FVRG+ AGAVKG Sbjct: 247 NLVNTSFGGKEYNVDMAAAIIAALPTLAVYVFAGKYFVRGLTAGAVKG 294 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 294 Length adjustment: 27 Effective length of query: 278 Effective length of database: 267 Effective search space: 74226 Effective search space used: 74226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory