Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate WP_111607572.1 DK187_RS11925 carbohydrate ABC transporter permease
Query= reanno::Smeli:SMc04257 (305 letters) >NCBI__GCF_003259225.1:WP_111607572.1 Length = 283 Score = 163 bits (412), Expect = 5e-45 Identities = 89/270 (32%), Positives = 150/270 (55%), Gaps = 11/270 (4%) Query: 38 VVALYYLLPLYVMIVTSLKGMPEIRVGNIFAPPLE-ITFEPWVKAWAEACTGLNCDGLSR 96 + L +LLPL +++TS + +I GN + P E + FE + + E + R Sbjct: 23 IALLLWLLPLIAVMLTSARSTADINAGNYWGIPSEWMLFENYALVFTET-------PMVR 75 Query: 97 GFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTILIVGAFIPYQVMIYPIVIV 156 NS+ IT+P+V ++A++++ GYALA ++F+G F I G F+P+Q+++ P+ + Sbjct: 76 YLLNSILITLPAVFGAVALSTLAGYALAKFKFRGNVALFAAFIAGNFVPFQILMIPVRDL 135 Query: 157 LREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELFKAARVDGAGFWTIYFKIML 216 MG+Y T +GLI+ H F TL RN+ GLP+EL +AARV+G W I++ I+L Sbjct: 136 TISMGLYDTASGLILFHIAFQTGFCTLFMRNFIVGLPDELIEAARVEGVSEWQIFWHIVL 195 Query: 217 PMSLPIFVVAMILQVTGIWNDFLFGVVFTR-PEYYPMTVQLNNIVNSVQGVKEYNVNMAA 275 P+ P +L T IWND+ + +V + E P+T ++ + Q + + + A Sbjct: 196 PLVRPALAALSVLIFTFIWNDYFWALVLVQSDEVRPITAGISALKG--QWMASWQLIAAG 253 Query: 276 TILTGLVPLTVYFVSGRLFVRGIAAGAVKG 305 +I+ L P+ ++F R F+ G+ GA KG Sbjct: 254 SIVAALPPVILFFAMQRHFIAGLTLGATKG 283 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 283 Length adjustment: 26 Effective length of query: 279 Effective length of database: 257 Effective search space: 71703 Effective search space used: 71703 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory