Align Ornithine aminotransferase 1; OAT 1; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase 1 (uncharacterized)
to candidate WP_111607900.1 DK187_RS13600 aspartate aminotransferase family protein
Query= curated2:Q4A0N2 (394 letters) >NCBI__GCF_003259225.1:WP_111607900.1 Length = 411 Score = 255 bits (651), Expect = 2e-72 Identities = 134/379 (35%), Positives = 220/379 (58%), Gaps = 9/379 (2%) Query: 9 DKYSSKNYSPLKLALAKGRGAKVWDIEDNCYIDCISGFSVVNQGHCHPKIIKALQEQSQR 68 D+ NY+P + +G G++VWD E Y+D G +V GH HP ++ ++EQ+ + Sbjct: 15 DEVMVPNYAPSAIIPVRGEGSRVWDKEGKEYVDFAGGIAVTALGHSHPTLVNVMREQAGQ 74 Query: 69 ITMVSRALYSDNLGKWEEKICKLANKENVLPMNTGTEAVETAIKMARKWGADIKNIDESS 128 I +S + ++ + +K+ + + V N+G EA E A K+AR++ D + Sbjct: 75 IWHLSNVMTNEPALRLAKKLTEKTFADRVFFANSGAEANEAAFKLARRYAFD--HFGPEK 132 Query: 129 SEIIAMNGNFHGRTLGSLSLSSQDSYKKGFGPLLNNIHYADFGDIEQLKKLINNQTTAII 188 EIIA +FHGRTL ++S+ Q YK+GF P I + D+ +IEQLK +I+++T A++ Sbjct: 133 HEIIAFYKSFHGRTLFTVSVGGQAKYKEGFEPTPGGIKHCDYNNIEQLKAIISDKTCAVV 192 Query: 189 LEPIQGEGGVNIPPTHFIQEVRQLCNEYNVLLIADEIQVGLGRTGKMFAMEWENTEPDIY 248 +EPIQGEGG+ F ++VR+LC++YN LL+ DE+Q G+GRTG ++A E PD+ Sbjct: 193 MEPIQGEGGIIPADIEFAKQVRELCDQYNALLVYDEVQSGVGRTGTLYAYEQLGVTPDVL 252 Query: 249 LLGKSLGGGLYPISAVLANQDVMSVLTPGTHGSTFGGNPLACAVSMAALDVLNEEHLVQN 308 K+LG G +P+ A+LA + L GTHGST+GGNP+ACA++ A +D+++ ++ Sbjct: 253 TTAKALGNG-FPVGAMLATEKAAKSLAFGTHGSTYGGNPMACAIAEAVIDIIDTPEVLGG 311 Query: 309 ALDLGDRLLKHLQQIESELIV--EVRGRGLFIGIE----LNVAAQDYCEQMINKGVLCKE 362 D+ L+ I + V ++RG GL +G E L A + + +G+ Sbjct: 312 VAKRHDQFFDGLKAINEKYHVFKDIRGMGLLMGAEVIDSLAGKAGEIVKAAAEEGLFVLV 371 Query: 363 TQGNIIRIAPPLVIDKDEI 381 N++R+AP L+I + +I Sbjct: 372 AGPNVLRLAPSLIITEQDI 390 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 411 Length adjustment: 31 Effective length of query: 363 Effective length of database: 380 Effective search space: 137940 Effective search space used: 137940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory