Align ABC transporter for D-Galactose and D-Glucose, permease component 1 (characterized)
to candidate WP_111608577.1 DK187_RS17245 sugar ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1895 (302 letters) >NCBI__GCF_003259225.1:WP_111608577.1 Length = 301 Score = 249 bits (636), Expect = 6e-71 Identities = 126/301 (41%), Positives = 194/301 (64%), Gaps = 3/301 (0%) Query: 4 VAVFSKAS-PFDALQRWLPKLVLAPSMLIVLVGFYGYII-WTFILSFTNSSFMPSYKWVG 61 +A +K S P A + + L+ + M IV +G + + ++ +LSFT S P++ WVG Sbjct: 1 MATSTKVSIPRRAKRVQISSLLASTPMAIVAIGVFVVCVGYSVMLSFTKSRLFPNFNWVG 60 Query: 62 LQQYMRLMDNDRWWVASKNLALFGGMFISISLVLGVFLAVLLDQRIRKEGFIRTVYLYPM 121 L QY RL RW V+ +NL ++G +FI + L+ G F+AV LDQ++R E RT++LYP Sbjct: 61 LDQYERLWGTSRWVVSVENLLIYGILFIVLCLIAGFFMAVFLDQKVRFESGFRTLFLYPY 120 Query: 122 ALSMIVTGTAWKWLLNPGLGLDKMLRDWGWEGFRLDWLVDQDRVVYCLVIAAVWQASGFV 181 A+S++VTG W+W++ P LG+ +++ GW F LVD +Y ++IAAVWQ+SG V Sbjct: 121 AMSLVVTGLVWQWMMEPSLGIQNVVQRMGWSSFEFAPLVDPQYAIYGVLIAAVWQSSGLV 180 Query: 182 MAMFLAGLRGVDQSIIRAAQVDGASLPTIYLKIVLPSLRPVFFSAFMILAHIAIKSFDLV 241 MA+ LAGLRG+D I +AA+VDG YL IVLP +RPV ++ ++LA ++ +DL+ Sbjct: 181 MALMLAGLRGIDGEIWKAARVDGIPTWQTYLFIVLPMMRPVMITSVVLLAVGVVRVYDLI 240 Query: 242 AAMTAGGPGYSSDLPAMFMYSFTFSRGQMGIGSASAMLMLGAVLTILVPYLYSE-LRGKR 300 A T GGPG S+++PA F+ +RG +G+G A+A +ML VL ++ P++Y E +R + Sbjct: 241 VAQTGGGPGMSTEMPAKFVIDHITARGNVGLGMAAATMMLLPVLLVIGPWIYREYVRPAK 300 Query: 301 H 301 H Sbjct: 301 H 301 Lambda K H 0.329 0.141 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 301 Length adjustment: 27 Effective length of query: 275 Effective length of database: 274 Effective search space: 75350 Effective search space used: 75350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory