Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_111608409.1 DK187_RS16380 D-glycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_003259225.1:WP_111608409.1 Length = 325 Score = 317 bits (811), Expect = 3e-91 Identities = 168/323 (52%), Positives = 219/323 (67%), Gaps = 3/323 (0%) Query: 2 KKIVAWKSLPEDVLAYLQQHAQVVQVDATQHD---AFVAALKDADGGIGSSVKITPAMLE 58 KK++ ++ +P + L + V + D AF AAL DA+G IG+S K++ +L Sbjct: 3 KKVILYRDIPVEERQRLDEQFNVTFFNGIHEDNKEAFKAALADAEGLIGTSTKMSAELLS 62 Query: 59 GATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELA 118 A +LKA STISVG D +D+ LT RGI L +TP VL E+TADT+F+LI+ +ARR +EL+ Sbjct: 63 LAPKLKAASTISVGTDLYDLNYLTERGIPLMHTPGVLNETTADTMFTLIMCTARRAIELS 122 Query: 119 EWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQ 178 V+ G W +IG AL+G DV GKTLGI+G+GRIG A+A+R GF+MK+ Y+NRS Sbjct: 123 NMVREGRWTSNIGEALYGTDVHGKTLGIIGMGRIGYAIAKRGHFGFDMKIQYSNRSRKLD 182 Query: 179 AEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVD 238 AE+ A +E+ ELL T+DFVC+ PLT ET+ LIGA E MK SAI IN SRG +D Sbjct: 183 AEQDLNATYMEMEELLKTSDFVCVMTPLTAETERLIGAKEFAMMKPSAIFINGSRGKVID 242 Query: 239 EKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNAA 298 E ALI+AL NGTI AGLDVFE EPL DSPL KL N V PHIGSAT ETR AM A Sbjct: 243 EAALIDALGNGTIRAAGLDVFEVEPLSGDSPLCKLDNAVLFPHIGSATAETRLAMITCAV 302 Query: 299 ENLVAALDGTLTSNIVNREVLSK 321 +NL+ AL+G ++ N N+ +L++ Sbjct: 303 DNLINALNGDISQNCANQHLLNR 325 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 325 Length adjustment: 28 Effective length of query: 293 Effective length of database: 297 Effective search space: 87021 Effective search space used: 87021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory