Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_111608296.1 DK187_RS15775 SDR family oxidoreductase
Query= reanno::acidovorax_3H11:Ac3H11_614 (280 letters) >NCBI__GCF_003259225.1:WP_111608296.1 Length = 254 Score = 221 bits (564), Expect = 1e-62 Identities = 117/251 (46%), Positives = 159/251 (63%), Gaps = 3/251 (1%) Query: 30 KFPSLQGRAVFVTGGGSGIGAAIVAAFAEQGARVAFVDVAREASEALAQHIADAGLPRPW 89 ++PSL+ VF+TGGGSGIG +V F +QGARVA++D+ +S AL Q ++D PW Sbjct: 7 QYPSLKDNVVFITGGGSGIGEYLVHHFIKQGARVAYIDIDEASSAALNQRLSDEFNVTPW 66 Query: 90 WRVCDVRDVQALQACMADAAAELGSDFAVLVNNVASDDRHTLESVTPEYYDERMAINERP 149 +R DVRD+ ALQ+ + DAA ELG VL+NN DDRHT+E+VTPEY+D + IN RP Sbjct: 67 FRKVDVRDIAALQSAINDAAQELGR-LDVLINNAGKDDRHTIENVTPEYWDNCLNINMRP 125 Query: 150 AFFAIQAVVPGMRRLGAGSVINLGSTGWQGKGTGYPCYAIAKSSVNGLTRGLAKTLGQDR 209 FF +QA M+ S+IN+GS W G Y +K +++ +TR +A+ LG Sbjct: 126 HFFGMQAAAKWMKE--GASIINMGSISWMRGRAGMVGYTTSKGAIHTMTRTMARELGPRG 183 Query: 210 IRINTVSPGWVMTERQIKLWLDAEGEKELARNQCLPDKLRPHDIARMVLFLASDDAAMCT 269 IR+N++ PG V+TERQ LWL E ++E Q L +++P DI M LFLAS D+ C Sbjct: 184 IRVNSIVPGAVVTERQKALWLTPELDQEFIDVQSLKFRIQPDDIVAMALFLASQDSRACA 243 Query: 270 AQEFKVDAGWV 280 Q F VDAG V Sbjct: 244 GQNFIVDAGIV 254 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 254 Length adjustment: 25 Effective length of query: 255 Effective length of database: 229 Effective search space: 58395 Effective search space used: 58395 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory