Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_111608233.1 DK187_RS15435 D-2-hydroxyacid dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_003259225.1:WP_111608233.1 Length = 314 Score = 146 bits (368), Expect = 7e-40 Identities = 93/289 (32%), Positives = 145/289 (50%), Gaps = 11/289 (3%) Query: 24 VVQVDATQHDAFVAALKDADGGIGSSVKITPAMLEGATRLKALSTISVGFDQFDVADLTR 83 +V+ + T + +KDAD + + V + A L A+ L+ + ++ G + D+ + Sbjct: 26 LVEYENTAAEKVAERIKDADIVLTNKVVLKGAALHQASNLRLVQVMATGMNNVDLEACAQ 85 Query: 84 RGIVLANTPDVLTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGV---DVQ 140 I + N D T S + F+++LA R +V + VKAG W S D+ Sbjct: 86 CNIAVQNVADYSTISVPEHTFAMLLALRRNLVAYLDDVKAGKWADSEYFCFLDYPIKDLS 145 Query: 141 GKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFV 200 G T+ I+G G +G VA A+ F M++L+ R + Y VE L +AD + Sbjct: 146 GSTMAIIGAGTLGKKVATIAS-AFGMRILFAERKGATIIRDGY----VEFESALKSADVI 200 Query: 201 CLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFE 260 + PLT E+K+LIG++E MK +L+N SRG VDE AL AL++G I GA DV Sbjct: 201 SVNCPLTAESKNLIGSSEFALMKPECLLLNISRGGIVDEYALKHALEHGQISGAAFDVAT 260 Query: 261 TEPLPSDSP---LLKLANVVALPHIGSATHETRHAMARNAAENLVAALD 306 EP+P D P L K N + PHI A++E + A + + + +D Sbjct: 261 QEPMPIDHPLQALTKYPNFLLTPHIAWASNEAMQTLVNMAMDKIASFVD 309 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 314 Length adjustment: 27 Effective length of query: 294 Effective length of database: 287 Effective search space: 84378 Effective search space used: 84378 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory