Align ABC transporter for D-Trehalose, permease component 2 (characterized)
to candidate WP_111605763.1 DK187_RS02525 carbohydrate ABC transporter permease
Query= reanno::Smeli:SM_b20327 (276 letters) >NCBI__GCF_003259225.1:WP_111605763.1 Length = 277 Score = 415 bits (1067), Expect = e-121 Identities = 201/267 (75%), Positives = 238/267 (89%) Query: 10 AFYALVAVIILVAVFPFYYAILTSLKSGTALFRIDYWPTDISLANYAGIFSHGTFVRNLG 69 AFYA+V VI+L++VFPFYYAILTS K+GT LF+++Y+P+ NY I ++G F+R+ Sbjct: 11 AFYAIVVVIVLISVFPFYYAILTSFKTGTDLFKVNYFPSSFDFRNYIDILNNGKFIRSTL 70 Query: 70 NSLLVATLVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVLAGLFELIRF 129 NS+ +A+ V +L LAVTA+YALARVRFRGRGLLL+TIL+VSMFPQIAVLAGLFELIRF Sbjct: 71 NSIFIASTTVVFALFLAVTASYALARVRFRGRGLLLMTILAVSMFPQIAVLAGLFELIRF 130 Query: 130 VGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGASPWVVITRVFMPLM 189 +GI+NTP A+I SY IFTLPFTVWVLTTFMRDLP+EIEEAAIVDGA+PWV+IT++FMPL+ Sbjct: 131 IGIYNTPWAMILSYTIFTLPFTVWVLTTFMRDLPVEIEEAAIVDGATPWVIITQIFMPLL 190 Query: 190 WPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIALLSGGSQFEIPWGNIMAASVI 249 WPALVTTGLLAFI AWNEFLFALTFT+S T RTVPVAIA+LSG SQ+E PWG IMAASV+ Sbjct: 191 WPALVTTGLLAFIGAWNEFLFALTFTASETMRTVPVAIAMLSGSSQYETPWGLIMAASVL 250 Query: 250 VTVPLVVLVLIFQRRIISGLTAGGVKG 276 VTVPLV+LVLIFQR+I+SGLTAGGVKG Sbjct: 251 VTVPLVILVLIFQRKIVSGLTAGGVKG 277 Lambda K H 0.332 0.143 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 277 Length adjustment: 25 Effective length of query: 251 Effective length of database: 252 Effective search space: 63252 Effective search space used: 63252 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory