Align SmoF, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_111607573.1 DK187_RS11930 sugar ABC transporter permease
Query= TCDB::O30832 (290 letters) >NCBI__GCF_003259225.1:WP_111607573.1 Length = 291 Score = 129 bits (324), Expect = 8e-35 Identities = 86/276 (31%), Positives = 144/276 (52%), Gaps = 7/276 (2%) Query: 12 LMISPAVILLFLWMIVPLSMTLYFSFLRYNLLMPGMESFTGWDNYYYFLTDPAFSAALTN 71 L ++PAVIL +++I P+ +++ SF ++ + G ++F G+ NY D F AL N Sbjct: 15 LFLAPAVILFVVYVIFPILQSIWLSFYEWDGI--GEKTFVGFRNYIELFEDYQFWVALKN 72 Query: 72 TILLVVGVLLITVVGGVLLALLLDQPFWGQGIVRVLVIAPFFVMPTVSALVWKNMFMNPV 131 + +V +L +G + +AL L+Q G +V+ + PF + V LV+ + F +P Sbjct: 73 NLYWMVFFMLAPPIG-LGIALFLNQKVMGIRLVKSMFFFPFVISQVVVGLVF-SWFYDPS 130 Query: 132 NGMFAHIARGLGLPPFDFLSQAPLASIIGIVA--WQWLPFATLILLTALQSLDREQMEAA 189 G+F G+ P LS + IVA W + + ++ LT L +L+ +Q+EAA Sbjct: 131 FGLFNKAIGLFGMEPVAILSDENWVTFGIIVAGLWPQIAYCMILYLTGLNNLNPDQIEAA 190 Query: 190 EMDGASALDRFIHITVPHLTRAITVVVLIQTIFLLGVFAEILVTTNGGPGTASTNITYLV 249 +DGA H+ +P L A + V++ I L F + T+GGP S+ + Y + Sbjct: 191 RLDGAHGWKMLRHVILPQLRPATFIAVVVTVIGALRSFDLVATMTSGGPFGTSSVLAYFM 250 Query: 250 YAQSLLNYDVGGGSAGGIVAVVLANI-VAIFLMRMI 284 Y QS+ NY G G+A V ++ +I +A FL RM+ Sbjct: 251 YEQSIFNYRAGYGAAIATVLFLIMDIYIAYFLWRML 286 Lambda K H 0.329 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 291 Length adjustment: 26 Effective length of query: 264 Effective length of database: 265 Effective search space: 69960 Effective search space used: 69960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory