Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate WP_111606971.1 DK187_RS08770 enoyl-CoA hydratase
Query= uniprot:A0A2Z5MCI7 (262 letters) >NCBI__GCF_003259225.1:WP_111606971.1 Length = 250 Score = 117 bits (292), Expect = 3e-31 Identities = 70/239 (29%), Positives = 123/239 (51%), Gaps = 5/239 (2%) Query: 18 VLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGADNFFCAGGNLNRLLENRA 77 VL L+ +NA+ DMY A AL S E + ++ ++ G F +G ++N + + A Sbjct: 15 VLCLNRTDKKNAITLDMYQALTNALRSAEHNDQVKVTMLYGLGGDFSSGNDINEFV-HIA 73 Query: 78 KDPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLALACDLIVAADDAKFVMS 137 + P + ++ + ++ L KP+IA V+G A G G ++ L CDL++A+ +A+ Sbjct: 74 QTP----EKMEAIMAFLQVLSCYKKPLIAGVEGRAVGVGATMLLHCDLVLASREARLQFP 129 Query: 138 YARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHELGVVNKLTKPGTARDAAV 197 + ++GL P+ S L Q + Q A E+L+ G+ + A + HE+G+VN L + G A A+ Sbjct: 130 FVQLGLVPEAASSHLLPQLVGHQKAFEILVLGEVVSATQAHEMGLVNHLCEEGEAYKLAL 189 Query: 198 AWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVASLHHREGLEGISAFLEK 256 +A + + +VA K L+ G + L+ E F L E + +AFL + Sbjct: 190 FYAQRIAALPVEAVALSKDLLKFRGQDDVQMALMREGRIFKDRLRSTEAHQAFTAFLSR 248 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 115 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 250 Length adjustment: 24 Effective length of query: 238 Effective length of database: 226 Effective search space: 53788 Effective search space used: 53788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory