Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_111609171.1 DK187_RS20570 SDR family oxidoreductase
Query= reanno::Korea:Ga0059261_1894 (259 letters) >NCBI__GCF_003259225.1:WP_111609171.1 Length = 256 Score = 230 bits (587), Expect = 2e-65 Identities = 114/250 (45%), Positives = 155/250 (62%), Gaps = 1/250 (0%) Query: 10 AAVYPSLKGKRVLVTGGGSGIGAGIVEGFARQGADVTFFDIAGAESQLLVERLSADGHKA 69 +A+YP LKG+ V ++GG +GIGA IVE +A+QGA F D+ L +RL DGH+ Sbjct: 6 SAIYPDLKGRSVFISGGATGIGAAIVEAYAKQGAKTAFVDLDEKAGTALAKRLKKDGHEV 65 Query: 70 CFERVDLTDVASLQAVIARLIKGAGGFDILVNNAANDDRHAIDEITEAYWDERLSVNLKH 129 FE D+T++ Q I G +L+NNAAND RH+++ +TE +DE + VN+KH Sbjct: 66 RFEVCDITNIQDYQGKIRAAADAFGPISVLLNNAANDVRHSLESLTEERFDELVGVNIKH 125 Query: 130 IFFCAQAVVPAMRARGGGAIVNLGSISWHLGLSDLVLYQTCKAAIEGLTRSLARDLGRDG 189 F AQAV P MR GGG+I+N GS+ W + + Y T KAA GLTRSLARDLG G Sbjct: 126 AMFAAQAVAPMMRKLGGGSIINFGSVGWMMATAGYPTYGTSKAATHGLTRSLARDLGGAG 185 Query: 190 IRATCVIPGNVRTPRQLK-WYSPEGEAEIVAAQCLDGRLAPEDVAAMVLFLASDDARLVT 248 IR ++PG V T +QL+ W E +I +QCL G++ PE +A M LFL SD A + + Sbjct: 186 IRVNTLVPGWVMTEKQLRMWVDDAAEEKIKQSQCLTGKVLPEHIANMALFLGSDAAAMCS 245 Query: 249 GHSYFVDAGW 258 ++ VD GW Sbjct: 246 AQNFIVDGGW 255 Lambda K H 0.321 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 256 Length adjustment: 24 Effective length of query: 235 Effective length of database: 232 Effective search space: 54520 Effective search space used: 54520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory