Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate WP_066329755.1 BLR17_RS09285 3-oxoadipyl-CoA thiolase
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_900100165.1:WP_066329755.1 Length = 405 Score = 234 bits (597), Expect = 3e-66 Identities = 160/416 (38%), Positives = 228/416 (54%), Gaps = 34/416 (8%) Query: 1 MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKE-VEDVVMGAAMQ 59 M + I+ RTPIG ++ G+L+ L I+ VKR P E +++V++G Q Sbjct: 1 MNHSYIIDAIRTPIG-SFGGSLSTLRADDLAALTIKELVKRNPNIPVEMIDEVILGNHNQ 59 Query: 60 QGATGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGES 119 G N+AR A L AGLP T T++R CASG+ A+ A+RS+ EI + GG E Sbjct: 60 AGEDNRNVARMASLLAGLPFTVPAQTVNRLCASGMSAVIDASRSIQVGDAEIMIAGGMEH 119 Query: 120 IS----------------LVQNDKMNTFHAVDPALEAIKGDVYMAMLDTAETVAKRYGIS 163 ++ D + V+P ++A+ G M + TAE + + Y IS Sbjct: 120 MTRSPWVISKTSKPFGNDAQMFDSSFGWRFVNPKMQAMYGTDAMGV--TAENLVEMYNIS 177 Query: 164 RERQDEYSLESQRRTAAAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITLSQDEGPRP 223 RE QD ++ SQ++ AAQQ + +EI PI DK G V+ D +DE + Sbjct: 178 REDQDLFAYNSQQKAFAAQQNWRLAEEIVPIE----FTDKK-GTVTVFD----KDEFVKG 228 Query: 224 ETTAEGLAGLKAV-RGEGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVS 282 TT E LA L+AV + E T+TAGNAS L+DG++A ++ S+K L P Sbjct: 229 NTTLEKLAALRAVFKKENGTVTAGNASGLNDGSAAMLLASEKAIKKYNLTPKARIVASAI 288 Query: 283 YGCEPDEMGIGPVFAVPRLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGI---DPEKL 339 G EP MGIGPV A + L++ GL++ DI + ELNEAFA Q L C LG+ DP ++ Sbjct: 289 VGVEPRIMGIGPVGATQKALEKAGLTLADIDIIELNEAFAAQSLACTRALGLADNDP-RI 347 Query: 340 NVNGGAISVGHPYGMSGARLAGHALIEGRRRKAKYAVVTMCVGGGMGSAGLFEIVH 395 N NGGAI++GHP GMSG R+ A IE +++ +YA+ TMC+G GMG A + E V+ Sbjct: 348 NPNGGAIALGHPLGMSGTRILQTATIELQKQNKRYALCTMCIGVGMGYAVIIENVN 403 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 405 Length adjustment: 31 Effective length of query: 364 Effective length of database: 374 Effective search space: 136136 Effective search space used: 136136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory