Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_066328829.1 BLR17_RS12975 glucose 1-dehydrogenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_900100165.1:WP_066328829.1 Length = 248 Score = 149 bits (375), Expect = 7e-41 Identities = 81/245 (33%), Positives = 140/245 (57%), Gaps = 4/245 (1%) Query: 22 KVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKADVSN 81 K V++TG GIG+A FA +VI+ A+K +V A +++ GAD+ L DV+N Sbjct: 3 KTVIITGGTTGIGKATALHFAKNGYNVVITSRNADKEASVIADFKQNGADITFLPLDVTN 62 Query: 82 QQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEE-DWRRCFAIDLDGAWYGCKAV 140 ++ + ++ V++ G++D +VN +G+++ L TE D ++ ++ G +YG K Sbjct: 63 EEQVKSVIETTVKKFGKLDSIVNNSGISLGNAVLAETESNDLKQMLETNVMGVYYGMKYA 122 Query: 141 LPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNAIAP 200 + +M++ G G+I+N+AS + + Y +KH ++GLT+ I+YA +G+RVNA+AP Sbjct: 123 IIEMLKTGGGTIVNLASIAGLNGLYATAQYNASKHAVVGLTKGASIDYAQQGIRVNAVAP 182 Query: 201 GYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPFINASCI 260 G I+T + N A + +HP R+G+ ++A FLASDE F+ + + Sbjct: 183 GAIKTDI---LKNAIASGTYDVSSIEAIHPMNRLGEVEDIAKAIYFLASDENTFMTGTIL 239 Query: 261 TIDGG 265 IDGG Sbjct: 240 NIDGG 244 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 248 Length adjustment: 24 Effective length of query: 248 Effective length of database: 224 Effective search space: 55552 Effective search space used: 55552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory