Align Beta-ketoadipyl-CoA thiolase; 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized)
to candidate WP_066329932.1 BLR17_RS08645 acetyl-CoA C-acyltransferase
Query= SwissProt::Q8VPF1 (401 letters) >NCBI__GCF_900100165.1:WP_066329932.1 Length = 392 Score = 258 bits (658), Expect = 3e-73 Identities = 157/401 (39%), Positives = 230/401 (57%), Gaps = 9/401 (2%) Query: 1 MSREVYICDAVRTPIGRFGGSLAAVRADDLAAVPVKALVERNPQVDWSQLDEVYLGCANQ 60 MS++V I AVRTPIG F G LA V A L A +K +++ +D + +DEV +G Q Sbjct: 1 MSKKVVIVAAVRTPIGSFMGGLANVSAPQLGAAAIKGALDKI-NLDPNLVDEVLMGNVIQ 59 Query: 61 AGEDNRNVARMALLLAGLPDSVPGVTLNRLCASGMDAVGTAFRAIASGEAELVIAGGVES 120 AG + AR A L AGL +++P T+N++CASGM AV A +AI +G+AE+V+AGG+E+ Sbjct: 60 AGV-GQAPARQAALFAGLKNTIPCTTINKVCASGMKAVMMAAQAIQTGDAEIVVAGGMEN 118 Query: 121 MSRAPYVMGKADSAFGRGQKIEDTTIGWRFINPLMKAQYGVDAMPETADNVADDYKVSRA 180 MS P+ + G K T+ + Y AM AD A+ Y +SR Sbjct: 119 MSLIPHY-----THLRSGTKFGPATLTDGMQRDGLVDAYDNQAMGVYADLCANQYNISRE 173 Query: 181 DQDAFALRSQQLAGRAQAAGYFAEEIVPVVIKGKKGETVVDADEHLRPDTTLEALAKLKP 240 +QD FA+ S + + +A G F E+VPV + ++GE +V A + + L+ + L Sbjct: 174 EQDNFAIESYRRSAQAWDTGKFDAEVVPVAVPQRRGEPIVIAKDEEYTNVKLDKIPSLNA 233 Query: 241 VNGPDKTVTAGNASGVNDGSVALILASAEAVKKHGLKARAKVLGMASAGVAPRVMGIGPV 300 V D TVTA NAS +NDG+ ALIL S E + LK A + A A P+ P Sbjct: 234 VFTKDGTVTAANASTINDGAAALILMSEEKAAELQLKPLAYIKSYADAAQEPKWFTTSPA 293 Query: 301 PAVRKLLERLNLSVADFDVIELNEAFAAQGLAVTRELGIADDDARVNPNGGAIALGHPLG 360 A+ K L++ +++ D D E NEAF+ GLA + LG+ D A+VN NGGA++LGHPLG Sbjct: 294 KALPKALDKAGITINDVDFFEFNEAFSVVGLANIKILGL--DSAKVNVNGGAVSLGHPLG 351 Query: 361 ASGARLVLTAVHQLEKSGGQRGLCTMCVGVGQGVALAVERV 401 SGAR++++ +H LE++ + G +C G G A+ +ER+ Sbjct: 352 CSGARILVSLLHILEQNNAKTGAAAICNGGGGASAIVIERI 392 Lambda K H 0.317 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 392 Length adjustment: 31 Effective length of query: 370 Effective length of database: 361 Effective search space: 133570 Effective search space used: 133570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory