Align protocatechuate 3,4-dioxygenase (subunit 2/2) (EC 1.13.11.3) (characterized)
to candidate WP_090660325.1 BLR02_RS03030 protocatechuate 3,4-dioxygenase subunit alpha
Query= BRENDA::Q0SH27 (237 letters) >NCBI__GCF_900101615.1:WP_090660325.1 Length = 193 Score = 101 bits (252), Expect = 9e-27 Identities = 63/191 (32%), Positives = 95/191 (49%), Gaps = 20/191 (10%) Query: 47 GPVFGDADVAKGENDMTHANGG---EAQGQRIIVHGRVLDSAGKPIPDTLIEVWQANAGG 103 GP F V +G+ND+T +G RI + GRVL G P + ++E WQA+A G Sbjct: 14 GPFFPHPFVQEGDNDLTRIAPDAPPSRRGSRIRLQGRVLREGGLPCVNAVVEAWQADAAG 73 Query: 104 RYRHKMDSWPAPLDPHFNGVARCLTDKQGHYEFTTIKPGAYPWGNHHNAWRPAHIHFSLF 163 R+RH D DP F G R +TD +G YEF T+ PG + R H++ + Sbjct: 74 RFRHPADPGWQEADPEFLGWGRAVTDAEGRYEFHTLLPGGF-------LDRAPHVNLLVM 126 Query: 164 GQAFTQRLVTQMYFPD-DPFFFQDPIYNSVPEAARERMISTFDYDHTRDNWAVGFKFDIV 222 + + T ++FP DP+ +P A R +++T ++ + GF+FDI+ Sbjct: 127 ASGLMRPVSTTLFFPGFSEANAADPVLGLLPAARRPLLVAT-------EDGSGGFRFDIL 179 Query: 223 LRG--RDATPF 231 LRG + TPF Sbjct: 180 LRGPASEETPF 190 Lambda K H 0.322 0.140 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 193 Length adjustment: 22 Effective length of query: 215 Effective length of database: 171 Effective search space: 36765 Effective search space used: 36765 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory