Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate WP_090664242.1 BLR02_RS18365 aspartate aminotransferase family protein
Query= reanno::pseudo3_N2E3:AO353_08585 (454 letters) >NCBI__GCF_900101615.1:WP_090664242.1 Length = 440 Score = 276 bits (706), Expect = 1e-78 Identities = 161/425 (37%), Positives = 238/425 (56%), Gaps = 21/425 (4%) Query: 22 PFSDFKQLKEKGPRIITNAKGVYLWDSEGNKILDGMAGLWCVAIGYGRDELADAASKQMR 81 PFSD + K PR++ A+G++ ++G +ILDG AGLWC G+GR E+ +A +Q Sbjct: 15 PFSDNRYFKSN-PRLLARAEGMFYHTADGQEILDGTAGLWCCNAGHGRREIKEAIQQQAA 73 Query: 82 ELPYYNLFFQTAHPPVLELAKAISDIAPEGMNHVFFTGSGSEGNDTMLRMVRHYWAIKGQ 141 L Y F Q HP E A I+++ PEGM+ +FFT SGSE DT L++ Y +G+ Sbjct: 74 ILDYAPTF-QLGHPIAFEAAARIAELTPEGMDRIFFTNSGSESADTALKIALAYHRARGE 132 Query: 142 PNKKVIISRINGYHGSTVAGASLGGMTYMHEQGDLPIPGIVHIPQPYW-----FGEGGDM 196 ++ +I R GYHG G S+GG+ +Q +P + H+P + F G Sbjct: 133 SSRVRLIGRERGYHGVGFGGMSVGGIGGNRKQFGALLPYVDHLPHTHGIEANLFARG--- 189 Query: 197 TPEEFGIWAANQLEEKILELGVDTVGAFIAEPIQGAGGVIIPPDSYWPRIKEILAKYDIL 256 E G A+ LE + G +T+ A + EP+ G+ GV++PP Y R++ I K+ IL Sbjct: 190 -LPEHGAERADALEALVALHGAETIAAVMVEPVAGSTGVLVPPRGYLERLRAICDKHGIL 248 Query: 257 FVADEVICGFGRTGEWFGSDFYGLKPDMMTIAKGLTSGYIPMGGLIVR----DEVVEVLN 312 + DEVI GFGR G FG++ G+ PD+MT+AKGLT+ +PMG + V+ D VV+ Sbjct: 249 LIFDEVITGFGRIGTNFGAERLGVTPDIMTMAKGLTNAAVPMGAVAVKNAVYDAVVDNAP 308 Query: 313 EGGDFNHGFTYSGHPVAAAVALENIRILREEKIIEHVRAETAPYLQKRLRELNDHPLVGE 372 G + HG+TYSGHP+AAA A+ + + R E + RA P Q+ L P V + Sbjct: 309 AGIELFHGYTYSGHPLAAAAAIATMELHRAEDLPGRARA-IEPLWQEATHSLKGLPNVVD 367 Query: 373 VRGVGLLGAIELVQDKATRARYVGKGVGMICRQFCFDNGLIMRAVGDTMIIAPPLVITKA 432 +R GL+ IEL A R G+ + R+ CFD G+++R GD + ++PPL+I K Sbjct: 368 IRDFGLIAGIEL----APRPGKPGQRGTEVFRR-CFDKGVLVRVTGDIIALSPPLIIEKP 422 Query: 433 EIDEL 437 +D L Sbjct: 423 HVDRL 427 Lambda K H 0.320 0.140 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 440 Length adjustment: 33 Effective length of query: 421 Effective length of database: 407 Effective search space: 171347 Effective search space used: 171347 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory