Align Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; EC 1.8.1.4 (characterized)
to candidate WP_090664166.1 BLR02_RS18050 FAD-dependent oxidoreductase
Query= SwissProt::P85207 (461 letters) >NCBI__GCF_900101615.1:WP_090664166.1 Length = 484 Score = 216 bits (551), Expect = 1e-60 Identities = 164/477 (34%), Positives = 237/477 (49%), Gaps = 38/477 (7%) Query: 1 MKTYDLIVIGTGPGGYPAAIRGAQLGLKVLAVEAAEVGGVCLNVGCIPTKALLHAAETVH 60 M +D++VIG G G A A LGLKV +E +GG CLN GC+P+KALL AA Sbjct: 1 MPDFDVVVIGAGAAGLSVAAISAGLGLKVALIERGRMGGDCLNYGCVPSKALLAAAHAAA 60 Query: 61 HLKGAEGFGLK-AKPELDLKKLGAWRDGVVKKLT-GGVAGLLKGNKVELLRGFARFKGPR 118 + A FG++ PE+D + A G + ++ A +G VE++ A F P Sbjct: 61 AARDAARFGIRLPPPEIDWAGVRAHVKGAIARIAPNDSAARFRGMGVEVIEASAHFVAPD 120 Query: 119 EIEVNGETYGAQSFIIATGSEPM-----PLKGFPFGEDVWDSTRALRVEEGIPKRLLVIG 173 IE G T + +IA GS + L G P W + L E P LL++G Sbjct: 121 AIEAGGRTLTFRRVVIAAGSSAIIPDLPGLDGVP-----WLTNETLFDLEEPPGHLLILG 175 Query: 174 GGAVGLELGQIYHRLGSEVTLIEYMPEILPAGDRETAALLRKALEKEGLKVRTGTKAVGY 233 GG +GLE+ Q + RLG VT+IE P I D E A LR +L ++G++ R G K V Sbjct: 176 GGPIGLEMAQAHARLGCLVTVIEAGPRIASREDPELAEGLRASLVRDGVEFREGVKLVRV 235 Query: 234 EK-KQDGLHVLLEAAQGG------SQEEIVVDKILVAVGRRPRTEGLGLEKAGVKVDERG 286 E+ + D L AAQ G I +L+AVGR PR GL L G++ RG Sbjct: 236 EQLEPDSL-----AAQAGVVAVLEDGSRIAGTHLLLAVGRAPRLAGLDLTAGGIESTPRG 290 Query: 287 FIQVNARMETSAPGVYAIGDVARPPLLAHKAMKEGLVAAENAA--GKNALFDF------- 337 + S V+A+GD+A P + +A VA+++A ++ LF Sbjct: 291 IVTGADLRSVSNKRVWAVGDIADPRGIGPRAFTH--VASQHAGILVRSMLFRLPFTKVSY 348 Query: 338 -QVPSVVYTGPEWAGVGLTEEEARKAGY-NVKVGKFPFSASGRALTLGGAEGLIKVVGDA 395 +P V Y PE A +GLTE EAR+AG+ ++ + ++P + + RA+ G EGL+K+V Sbjct: 349 AALPRVTYGDPELAQIGLTEAEAREAGHTDLALLRWPVAENDRAVAEGRTEGLVKLV-VG 407 Query: 396 ETDLLLGVFVVGPQAGELIAEATLALEMGATVSDLGLTIHPHPTLSEGLMEAAEALH 452 + LLG ++ P AGE+ L + +S L + P+PTLSE AA + Sbjct: 408 KGGRLLGAGLLAPHAGEMAGMFGLMIGRKLPLSALAGMVLPYPTLSEAAKRAASEFY 464 Lambda K H 0.316 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 615 Number of extensions: 32 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 484 Length adjustment: 33 Effective length of query: 428 Effective length of database: 451 Effective search space: 193028 Effective search space used: 193028 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory