Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate WP_090663360.1 BLR02_RS12085 aspartate aminotransferase family protein
Query= reanno::pseudo3_N2E3:AO353_08585 (454 letters) >NCBI__GCF_900101615.1:WP_090663360.1 Length = 443 Score = 234 bits (597), Expect = 4e-66 Identities = 148/442 (33%), Positives = 229/442 (51%), Gaps = 34/442 (7%) Query: 34 PRIITNAKGVYLWDSEGNKILDGMAGLWCVAIGYGRDELADAASKQMRELPYYNLFFQTA 93 P + +G+YL+D G I+DG G +G+G + +A Q+ +L Y A Sbjct: 13 PPLALRGEGIYLYDQSGRAIIDGSGGAAVACLGHGHPRVIEAIKAQLDKLAY-------A 65 Query: 94 HPPVL--ELAKAISDIA----PEGMNHVFFTGSGSEGNDTMLRMVRHYWAIKGQPNKKVI 147 H + E A+ ++DI P G+ H +F SGSEGN+ ++M R Y+ GQP + Sbjct: 66 HTALFSCESAEELADIMVGHRPGGLTHAYFCSSGSEGNEAAIKMARQYFLEIGQPERTRF 125 Query: 148 ISRINGYHGSTVAGASLGGMTYMHEQGDLPI--PGIVHIPQPYWFGEGGD-MTPEEFGIW 204 I+R YHG+T+ S GG M P+ P H+ Y + + + + E++ Sbjct: 126 IARRQSYHGNTLGALSAGGNA-MRRAPYQPLLSPAFSHVSPCYAYRDRAEGESDEQYVAR 184 Query: 205 AANQLEEKILELGVDTVGAFIAEPIQGAG-GVIIPPDSYWPRIKEILAKYDILFVADEVI 263 A++LE + LG DTV AF+AE + GA G + Y+P +K + ++ L + DEV+ Sbjct: 185 LADELEAEFQRLGPDTVIAFMAETVVGATLGCVTALPGYFPAMKAVCDRHGALLILDEVM 244 Query: 264 CGFGRTGEWFGSDFYGLKPDMMTIAKGLTSGYIPMGGLIVRDEVVEVLNEG-GDFNHGFT 322 G GR G + G+ PD+ +AKGL GY P+GG++V V+E L G G F HG T Sbjct: 245 SGMGRCGALHTWEQEGVTPDIQIVAKGLGGGYQPIGGILVHGRVIEGLTGGTGAFMHGHT 304 Query: 323 YSGHPVAAAVALENIRILREEKIIEHVRAETAPYLQKRLRELNDHPLVGEVRGVGLLGAI 382 Y HPVA A A+ +++ EE+++++V+A A Q+ +H VG++RG GL AI Sbjct: 305 YQAHPVACAAAVAVQKVIAEERLLDNVQAMGARLEQRLTERFGNHRHVGDIRGRGLFWAI 364 Query: 383 ELVQDKA------------TRARYVGKGVGMICRQFCFDNGLIMRAVGDTMIIAPPLVIT 430 ELV+D+A R + G+ C G I GD I+APP + T Sbjct: 365 ELVEDRAGKSVFDPALKLNERVKMQAYERGLACYPM---GGTIDGRRGDHAILAPPYIAT 421 Query: 431 KAEIDELVTKARKCLDLTLSAL 452 A+IDE+V + + +D L++L Sbjct: 422 AAQIDEIVDRFGEAVDAALASL 443 Lambda K H 0.320 0.140 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 31 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 443 Length adjustment: 33 Effective length of query: 421 Effective length of database: 410 Effective search space: 172610 Effective search space used: 172610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory