Align 3-oxoadipate CoA-transferase (subunit 1/2) (EC 2.8.3.6) (characterized)
to candidate WP_043340922.1 BLR02_RS16985 3-oxoacid CoA-transferase subunit B
Query= BRENDA::P0A102 (213 letters) >NCBI__GCF_900101615.1:WP_043340922.1 Length = 212 Score = 223 bits (569), Expect = 2e-63 Identities = 110/206 (53%), Positives = 150/206 (72%), Gaps = 2/206 (0%) Query: 8 SRTEMAQRVAADIQEGAYVNLGIGAPTLVANYLGD-KEVFLHSENGLLGMGPSPAPGEED 66 +R +MA R+A D+ EG VNLGIG PT+VAN++ +EV SENG++GMGP+P G+ED Sbjct: 4 NRDQMAARLADDVPEGWCVNLGIGMPTMVANHVPPTREVIFQSENGVIGMGPAPKEGQED 63 Query: 67 DDLINAGKQHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWHTGAEGS 126 LINAGKQ +TL G +F HADSF+M+RGGH+D+ VLG F+V+ GDLANW T + Sbjct: 64 PWLINAGKQLITLAKGASFVGHADSFAMIRGGHIDLCVLGGFEVAENGDLANWATSENDT 123 Query: 127 IPAVGGAMDLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLAVLEVTP 186 PAVGGAMDLA GA++++V+M+H TK G K+V C YPLTG+ACV+R+YT+LAVL+V Sbjct: 124 APAVGGAMDLAAGAKRLWVIMEHTTKDGRPKIVERCGYPLTGLACVNRVYTNLAVLDVVE 183 Query: 187 -EGLKVVEICADIDFDELQKLSGVPL 211 +G V ++ + +E+Q +G L Sbjct: 184 GKGFVVRDLAPGVTLEEVQAKTGATL 209 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 212 Length adjustment: 21 Effective length of query: 192 Effective length of database: 191 Effective search space: 36672 Effective search space used: 36672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory