Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate WP_090663807.1 BLR02_RS15295 NAD-binding protein
Query= reanno::pseudo3_N2E3:AO353_05985 (294 letters) >NCBI__GCF_900101615.1:WP_090663807.1 Length = 303 Score = 175 bits (443), Expect = 1e-48 Identities = 107/292 (36%), Positives = 159/292 (54%), Gaps = 12/292 (4%) Query: 2 KIAFIGLGNMGAPMARNLIKAGHSLNLVDLNKAVLAELAQLGGTISATAREAAQGAELVI 61 KI FIGLG MG MA ++ + H L + D+ +A L +LG + +A AQ +++V+ Sbjct: 7 KIGFIGLGRMGRGMASSIRRKQHPLTVHDIAPGPVAALEELGAASAGSAAAVAQASDVVL 66 Query: 62 TMLPAAVHVRSVWLGEDGVLAGIAKGVPAVDCSTIDPQTARDVAAAAAKQGVAMADAPVS 121 TMLP V+S LG DG+LA I G +D ST+DP+T +AAA A++G+ DAPV Sbjct: 67 TMLPGPKEVQSSILGTDGILANIKPGGLVMDMSTVDPETTDALAAACAERGIGFVDAPVG 126 Query: 122 GGTGGAAAGTLTFMVGATPELFATLQPVLAQMGRNIVHCGEVGTGQIAKICNNLLLAISM 181 A G FMVGA+ FA + P+L MG I HCG GTG K+ NN L I Sbjct: 127 RLAWHADRGESLFMVGASDADFARVSPLLEAMGSTIHHCGGPGTGTRTKLVNNYLAIILC 186 Query: 182 VGVSEAMALGDALGIDTQVLAGIINSSTGRCWSSEMYNPWPGIV---ETAPASRGYTGGF 238 +EA++L A G+D + +++ +T + ++ WP V +T P GF Sbjct: 187 QLNAEALSLSAAFGLDLEKTLEVLHGTTAT--NGQLKVNWPNKVLAGDTEP-------GF 237 Query: 239 GAELMLKDLGLATEAARQAHQPVMLGAVAQQLYQAMSQRGEGGKDFSAIINS 290 +L KDL L +AA A + + A+ ++ + + RG G KDFSA++++ Sbjct: 238 AIDLAHKDLSLIVQAANAAKVTLPVAAITREAFSSARGRGWGQKDFSAMLDA 289 Lambda K H 0.317 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 303 Length adjustment: 27 Effective length of query: 267 Effective length of database: 276 Effective search space: 73692 Effective search space used: 73692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory