Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate WP_090665423.1 BLR02_RS27610 carbohydrate ABC transporter permease
Query= reanno::Dino:3607127 (272 letters) >NCBI__GCF_900101615.1:WP_090665423.1 Length = 275 Score = 173 bits (438), Expect = 4e-48 Identities = 88/260 (33%), Positives = 150/260 (57%), Gaps = 4/260 (1%) Query: 14 LVLIITVCVFPFYWMVTTSLKTQIVALEAPPVWIFEP-TLSNYREALFEDGVLRTLINSL 72 ++++I + F WM++ SLK ++ PPV+I +P TL NYR+ + L NS+ Sbjct: 17 VLVLIAPAILVFLWMLSLSLKNELDNTAWPPVFIPDPPTLDNYRDVFARNDFLLYARNSV 76 Query: 73 IIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLIARNLGL 132 I++ TFLALV+GVPA + +A+ L + R+ + +P FL+ + L + Sbjct: 77 IVSFGATFLALVIGVPAGYGIAKMRAMRAAAL---ILIARITPGLSYLIPLFLLFQWLEM 133 Query: 133 LDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICLPLAMPG 192 +++ +L +PIV+W++ F G+P +L+EAA ++GA+ + R + +PLA PG Sbjct: 134 TGTLWPIVITHLVITVPIVVWVMISFFEGLPTELEEAALVDGATIWQAFRHVAMPLARPG 193 Query: 193 VAVSAIFSFIFSWNELMFGLILTRSEAKTAPAMAVSFMEGYNLPYGKIMATSTLIVIPVL 252 + V+ I +FIFSWN +F ++L E +T P + + + +G + A + L+ +PVL Sbjct: 194 ITVATILAFIFSWNNFVFAMVLAGRETRTLPVAVNNMLTFEQISWGPLSAAALLVTLPVL 253 Query: 253 IFALIASKQLVRGLTMGAVK 272 + L+A KQ+V GLT G VK Sbjct: 254 LLTLLAQKQIVAGLTAGGVK 273 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 275 Length adjustment: 25 Effective length of query: 247 Effective length of database: 250 Effective search space: 61750 Effective search space used: 61750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory