GapMind for catabolism of small carbon sources

 

Protein WP_090272717.1 in Pseudomonas litoralis 2SM5

Annotation: NCBI__GCF_900105005.1:WP_090272717.1

Length: 357 amino acids

Source: GCF_900105005.1 in NCBI

Candidate for 78 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med PotG aka B0855, component of Putrescine porter (characterized) 43% 95% 276.9 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
trehalose catabolism thuK med Trehalose import ATP-binding protein SugC; EC 7.5.2.- (characterized) 47% 75% 255.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-cellobiose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 43% 90% 253.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-glucose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 43% 90% 253.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
lactose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 43% 90% 253.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-maltose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 43% 90% 253.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
sucrose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 43% 90% 253.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
trehalose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 43% 90% 253.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-xylose catabolism gtsD med ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 43% 90% 253.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-maltose catabolism malK med Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 44% 90% 252.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 42% 91% 252.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 46% 76% 250.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-galactose catabolism PfGW456L13_1897 med ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 46% 76% 247.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 41% 91% 246.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
lactose catabolism lacK med LacK, component of Lactose porter (characterized) 43% 84% 244.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 42% 86% 244.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-arabinose catabolism xacJ med Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 41% 90% 240 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 44% 78% 239.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 49% 70% 239.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 77% 236.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
sucrose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 44% 77% 236.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 43% 78% 235.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 44% 75% 232.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 92% 228 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 40% 92% 228 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-cellobiose catabolism SMc04256 med ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 42% 84% 226.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 40% 80% 223 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 41% 77% 222.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-maltose catabolism malK_Sm med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 42% 78% 222.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
trehalose catabolism malK med MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 42% 78% 222.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 44% 75% 204.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-proline catabolism opuBA med BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 41% 74% 183 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 40% 80% 149.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 93% 228.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 93% 228.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 38% 93% 228.4 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 38% 88% 227.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 221.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 221.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 221.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 221.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 221.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 38% 87% 221.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 39% 83% 221.5 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 39% 87% 217.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 78% 190.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 78% 190.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 78% 190.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 78% 190.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 33% 90% 177.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 35% 96% 157.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-glutamate catabolism gltL lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 35% 96% 157.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 38% 90% 156 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 89% 154.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 89% 154.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 89% 154.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 89% 154.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 38% 89% 154.1 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 36% 98% 153.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 36% 98% 153.3 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 31% 84% 152.9 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 84% 151.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 84% 151.8 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 34% 90% 150.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 34% 90% 150.6 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-arginine catabolism artP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 35% 97% 146 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 35% 97% 146 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-lysine catabolism hisP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 35% 97% 146 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-alanine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 94% 115.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 94% 115.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-leucine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 94% 115.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-proline catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 94% 115.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-serine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 94% 115.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
L-threonine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 94% 115.2 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-fructose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 93% 106.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-mannose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 93% 106.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
D-ribose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 93% 106.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6
sucrose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 30% 93% 106.7 Putative ABC transporter component, component of The γ-aminobutyrate (GABA) uptake system, GtsABCD 44% 286.6

Sequence Analysis Tools

View WP_090272717.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTSDYVSFRNVQKSYDGDTLVVKNFSLDISKGEFLTMLGPSGSGKTTCLMMLAGFETPTS
GEIRLDGQMINKMAPHKRGIGMVFQNYALFPHMTIAENLAYPLTVRKMPKAEIEQRVNTS
LDMVEMRDKKNRTPGQLSGGQKQRIALARALIFEPKLVLMDEPLGALDKNLREQMQYEIK
RLHERLGITAVYVTHDQTEALTMSDRIAVFDDGIVQQVASPSVLYEEPATAFVANFIGEN
NAFAGRLGRLANGKRQIEMPNSFIQTEHDSAGQEGSPVVLSVRPERIMLAPGEDVENRFT
ARVKELIYHGDHIRACVRVFDQSDVVLKLINSPGLRVPTLGEQVTIGWRASDCRALV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory