Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_090272108.1 BLU11_RS03755 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_900105005.1:WP_090272108.1 Length = 256 Score = 252 bits (644), Expect = 5e-72 Identities = 134/263 (50%), Positives = 179/263 (68%), Gaps = 9/263 (3%) Query: 9 MSDDTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTM 68 MS LL V L M+FGGL+A++ + + + G I +LIGPNGAGKTTVFNC+TGFYKP+ Sbjct: 1 MSAAPLLDVSGLCMRFGGLLAVDQVALQVEEGQIVSLIGPNGAGKTTVFNCLTGFYKPSA 60 Query: 69 GMITFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKAS 128 G I F+ + + +P F++ + V RTFQ++RLF ++V+ENLLVAQH+ + + Sbjct: 61 GSIRFHGEE-----VSGMPGFKLARMGMV-RTFQHVRLFKQMSVVENLLVAQHHHM---N 111 Query: 129 GYTILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCT 188 + GL+ ++R EA++ A WLE+ L++ A+ AG L YG QRRLEIAR M T Sbjct: 112 TNMLAGLLKTPSFRRSEKEALDRAAQWLERTGLLEFANRTAGTLAYGQQRRLEIARCMVT 171 Query: 189 GPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYG 248 P LL LDEPAAGLNPRE+ L AL+ +R+E G +ILLIEHDM +VM ISDHVVV+ G Sbjct: 172 QPRLLMLDEPAAGLNPRETVDLQALIAELRSEHGLTILLIEHDMKLVMGISDHVVVINQG 231 Query: 249 QKISDGTPDHVKNDPRVIAAYLG 271 ++ GTP+ V DP VI AYLG Sbjct: 232 CPLAAGTPEQVCRDPEVIKAYLG 254 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 256 Length adjustment: 25 Effective length of query: 267 Effective length of database: 231 Effective search space: 61677 Effective search space used: 61677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory