Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate WP_090275926.1 BLU11_RS18580 aspartate aminotransferase family protein
Query= reanno::WCS417:GFF5299 (454 letters) >NCBI__GCF_900105005.1:WP_090275926.1 Length = 447 Score = 288 bits (737), Expect = 2e-82 Identities = 167/434 (38%), Positives = 247/434 (56%), Gaps = 27/434 (6%) Query: 17 DHHLAPFSDFKQLKEKGPRIITKAHGVYLWDSEGNKILDGMAGLWCVAIGYGRDELADAA 76 D + P+S +Q K PR+I A G Y D++G KI DG++GLWC G+ R E+A+A Sbjct: 18 DAYWLPYSANRQFKSD-PRLIVGAEGSYYIDADGRKIFDGLSGLWCCGAGHNRPEIAEAV 76 Query: 77 AKQMKELPYYNLFFQTAHPPVLELAKAISDIAPAGMNHVFFTGSGSEGNDTMLRMVRHYW 136 AKQ++EL Y F Q HP ELA+ I+ + P G++HVF+T SGS+ DT L++ R YW Sbjct: 77 AKQLRELDYAPAF-QFGHPKAFELAERITQLTPKGLDHVFYTNSGSDAADTSLKIARAYW 135 Query: 137 AIKGQPNKKTIISRKNGYHGSTVAGASLGGM---TYMHEQGDLPIPGITH-IAQPYWFGE 192 KG+P K +I R GYHG G SLGG+ + QG + ++H + + F Sbjct: 136 RKKGKPTKTKLIGRAKGYHGVNFGGISLGGIGANRMLFGQG-IDADHLSHTLLKENLFSR 194 Query: 193 GGDMSPEEFGVWAANQLEEKILELGVDNVGAFIAEPIQGAGGVIVPPATYWPRIKEILAK 252 G PE GV A L E I N+ A I EP+ G+ GV+ PP Y R++EI + Sbjct: 195 G---MPER-GVERAEDLLELIALHDASNIAAVIVEPMAGSAGVLPPPVGYLQRLREICDQ 250 Query: 253 YDILFIADEVICGFGRTGEWFGSDFYDLKPHMMTIAKGLTSGYIPMGGLIVRDEVVEVLN 312 ++IL I DEVI GFGR G G++ + + P MM +AK LT+G +PMG +IV+ E+ + Sbjct: 251 HEILLIFDEVITGFGRMGSNTGAEEFGVTPDMMNVAKQLTNGAVPMGAVIVQREIYQTFM 310 Query: 313 EGG------DFNHGFTYSGHPVAAAVALENIRIMRDEKIVNRVHDETAPYLQKRLRELAD 366 E G + HG+TYSGHPVA A AL ++ I++++++V+RV E +P + L L Sbjct: 311 EQGGPDYAIELPHGYTYSGHPVACAAALASLDILQNDRLVDRVR-EMSPIFENALHGLKG 369 Query: 367 HPLVGEVRGVGMLGAIELVQ--DKATRKRYEGKGVGMICRTFCFENGLIMRAVGDTMIIS 424 V ++R GM GA+++ + R+ YE C+E G +R GDT+ + Sbjct: 370 TRYVTDIRNYGMAGALQIESRPGEPARRPYE-------IAMKCWEKGFYVRYGGDTIQLG 422 Query: 425 PPLVISKAEIDELV 438 P ++ + EID ++ Sbjct: 423 MPFIVEREEIDNVI 436 Lambda K H 0.320 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 586 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 447 Length adjustment: 33 Effective length of query: 421 Effective length of database: 414 Effective search space: 174294 Effective search space used: 174294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory