Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_090274680.1 BLU11_RS14815 polyamine ABC transporter ATP-binding protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_900105005.1:WP_090274680.1 Length = 378 Score = 123 bits (308), Expect = 9e-33 Identities = 82/243 (33%), Positives = 140/243 (57%), Gaps = 17/243 (6%) Query: 65 AVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPPGKIISGKVIFNGMDIFSMTID 124 AV+DV+ + +GEI ++G SGSGK+TL+ IL P + G+V+ +G +I ++ Sbjct: 35 AVDDVTLTINRGEIFALLGGSGSGKSTLLR-ILAGFETPSE---GRVLLDGQNITALPPH 90 Query: 125 EFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHGEADKKRVIERASELLKLVGLD 184 + + I+ + Q+ AL P + + + + + + ER +E+LKLV + Sbjct: 91 K------RPINMMFQSY--ALFPHMTVEQNIAF-GLKQDKLSNTEISERVAEMLKLVHM- 140 Query: 185 PARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPTSALD-MLNQELLLKLIKNINQ 243 A+ K P QLSGG +QRV +A SL PKL+L+DEP ALD L ++ L+L++ I + Sbjct: 141 -AKYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVE-IIE 198 Query: 244 EMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEEIIKSPLNPYTSLLVSSIPSLK 303 +GVT + VTHD +A R+ +M +G++++ G +I +SP+N + + V S+ + Sbjct: 199 RVGVTCIMVTHDQEEAMTMAQRIAIMDQGWIVQVGTPMDIYESPVNRHVAEFVGSVNIFE 258 Query: 304 GEV 306 GE+ Sbjct: 259 GEI 261 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 378 Length adjustment: 30 Effective length of query: 332 Effective length of database: 348 Effective search space: 115536 Effective search space used: 115536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory