Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate WP_090272859.1 BLU11_RS08070 NAD-dependent succinate-semialdehyde dehydrogenase
Query= metacyc::MONOMER-11560 (497 letters) >NCBI__GCF_900105005.1:WP_090272859.1 Length = 486 Score = 301 bits (772), Expect = 3e-86 Identities = 175/472 (37%), Positives = 265/472 (56%), Gaps = 8/472 (1%) Query: 21 RAFINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLAP 80 + ++NG++ +A SGET +P +G L V A+ AV+ A + W + Sbjct: 15 QCYVNGQWQNASSGETLAVDNPANGDVLGHVPVLSAAEVGAAVDAASSALRQ--WRKRTA 72 Query: 81 AKRKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVYD 140 +R L+ + DL+ ++ E+LA L TL+ GKP+ +S +I AA I W AE ++Y Sbjct: 73 QERADCLLAWHDLMLEHKEDLATLMTLEQGKPLVESQG-EIDYAASFIRWFAEEARRMYG 131 Query: 141 EVAPTPH-DQLGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEKSPLT 199 E P Q +VTR+PVGV AI PWNFP M K G ALA G ++++KP+ +P + Sbjct: 132 ETIPGARIGQHIVVTRQPVGVCAAITPWNFPAAMITRKAGAALAAGCTIIVKPASATPFS 191 Query: 200 AIRIAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVYAGES 259 A+ +A LA EAGIP GV NV+ G + + L V L FTGST + ++LM E Sbjct: 192 ALALAVLAEEAGIPHGVFNVVTGKAGEISEVLTRSPVVRKLSFTGSTDVGRRLMAQCSE- 250 Query: 260 NMKRIWLEAGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDKFL 319 +++++ LE GG +P IVF DA D+ A E A N G+ C +R LV+ + DKF+ Sbjct: 251 HIQKVSLELGGNAPFIVFDDA-DISRAVEGAMVCKFRNTGQTCVCANRFLVQSGVHDKFV 309 Query: 320 PMVVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTLEETG 379 + EA+ + G+ +P T AL++ + V+ + + GAK + G + Sbjct: 310 AALAEAMGKLRIGDGFEPGVTQSALINGDAVEKVIEHFDDAMAKGAKRVCGPAPDADR-- 367 Query: 380 GTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIWTSDIS 439 G YV+P + + M + EE FGP+ +V+ FDT EEA+ +AN TP+GLAA ++ DI Sbjct: 368 GNYVQPVLLTDINTNMTLCHEETFGPLAAVLRFDTEEEAIELANATPFGLAAYFYSRDIH 427 Query: 440 KAHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELK 491 + + A A+ AG + +N+ + APFGG K+SG GR+ S H L++YTELK Sbjct: 428 RVWRVADALEAGIIGINEGLISNPMAPFGGVKESGLGREGSRHGLDEYTELK 479 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 564 Number of extensions: 26 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 486 Length adjustment: 34 Effective length of query: 463 Effective length of database: 452 Effective search space: 209276 Effective search space used: 209276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory