Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_090274680.1 BLU11_RS14815 polyamine ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_900105005.1:WP_090274680.1 Length = 378 Score = 203 bits (517), Expect = 5e-57 Identities = 117/318 (36%), Positives = 186/318 (58%), Gaps = 24/318 (7%) Query: 6 VKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD 65 ++ VSK F +A+D+V + I GE F +LG SG+GK+T +RI+AG + PS G + D Sbjct: 23 IERVSKQFDDA--LAVDDVTLTINRGEIFALLGGSGSGKSTLLRILAGFETPSEGRVLLD 80 Query: 66 DRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVA 125 + + + +PP R I M+FQ++AL+P++T +NIAF L K+S EI +RV E+ Sbjct: 81 GQNITA-----LPPHKRPINMMFQSYALFPHMTVEQNIAFGLKQDKLSNTEISERVAEML 135 Query: 126 KILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKE 185 K++ + P +LSGGQ+QRVALAR+L K P LLLLDEP LD ++R + + E Sbjct: 136 KLVHMAKYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVE 195 Query: 186 VQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEIN 245 + R+GVT ++V+HD + +A R+ ++ +G +VQVG P D+Y++PV+ VA +G +N Sbjct: 196 IIERVGVTCIMVTHDQEEAMTMAQRIAIMDQGWIVQVGTPMDIYESPVNRHVAEFVGSVN 255 Query: 246 ELEGKVT---NEGVVIGSLRFPVSV----------SSDRAIIGIRPEDVKLSKDVIKDD- 291 EG++ ++ V+I + + AI +RPE V ++ + + Sbjct: 256 IFEGEIVADMDDHVIIECPQLDRQIYLGHGVTTRAEDKSAIYALRPEKVFVTTEQPEQPY 315 Query: 292 SWILVGKGKVKVIGYQGG 309 +W G+V I Y GG Sbjct: 316 NW---AHGEVHDIAYLGG 330 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 378 Length adjustment: 30 Effective length of query: 323 Effective length of database: 348 Effective search space: 112404 Effective search space used: 112404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory