Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_090273257.1 BLU11_RS10295 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_900105005.1:WP_090273257.1 Length = 368 Score = 193 bits (491), Expect = 5e-54 Identities = 126/339 (37%), Positives = 198/339 (58%), Gaps = 24/339 (7%) Query: 21 LDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPE 80 + +++I++ G+ +LGPSG GKTT +R IAG + S GE+ RL++S VPPE Sbjct: 21 VQDLSIHLRAGDIGCLLGPSGCGKTTTLRSIAGFEPISDGEIRLGGRLLSSQTHN-VPPE 79 Query: 81 DRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKR-VEEVAKILDIHHVLNHFPR 139 R+IGMVFQ +AL+P+LT +NIAF + +K RK+ V E+ +++ + + +P Sbjct: 80 QRRIGMVFQDYALFPHLTVAQNIAFGI-----NKHPKRKQIVGELLELVKLGKLGQRYPH 134 Query: 140 ELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSH 199 ELSGGQQQRVALARAL +P LLLLDEPFSNLD +R V+++ G + ++V+H Sbjct: 135 ELSGGQQQRVALARALAPEPELLLLDEPFSNLDGELRRRLSGEVRDILKARGTSAMLVTH 194 Query: 200 DPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKV-------T 252 D ++ FA+ D+VGVL +G+L Q P +LY P + VAS IG+ + G++ T Sbjct: 195 DQSEAFAVCDQVGVLREGRLQQWDTPYNLYHEPATPFVASFIGQGYFIRGQLLTPDTVQT 254 Query: 253 NEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFR 312 GV+ G+ + ++ S ++ +RP+ D++ + L KV L+R Sbjct: 255 ELGVIRGNRAYQLAAGSAVDVL-LRPD------DIVGQEGSSLTAIITGKVFLGASTLYR 307 Query: 313 ITITPLDSEEEIF-TYSDHPIHSGEEVLVYVRKDKIKVF 350 + + + E IF ++ DHP+ GE + + + D + VF Sbjct: 308 LQLPTGSTLETIFPSHDDHPL--GEVLGIRISADHLVVF 344 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 368 Length adjustment: 29 Effective length of query: 324 Effective length of database: 339 Effective search space: 109836 Effective search space used: 109836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory