Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate WP_090272717.1 BLU11_RS07240 ABC transporter ATP-binding protein
Query= TCDB::P73721 (252 letters) >NCBI__GCF_900105005.1:WP_090272717.1 Length = 357 Score = 141 bits (356), Expect = 2e-38 Identities = 85/244 (34%), Positives = 142/244 (58%), Gaps = 10/244 (4%) Query: 5 TAPLISFDQLQKNF-GALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGG 63 T+ +SF +QK++ G V++ + +I + ++++GPSG GK+T L L E + G Sbjct: 2 TSDYVSFRNVQKSYDGDTLVVKNFSLDISKGEFLTMLGPSGSGKTTCLMMLAGFETPTSG 61 Query: 64 RLEVAGVDLSGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEA 123 + L G I++ + + +GMVFQ++ LFPH+T+ +NL P V ++P AE Sbjct: 62 EIR-----LDGQMINK--MAPHKRGIGMVFQNYALFPHMTIAENLAY-PLTVRKMPKAEI 113 Query: 124 KDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVG 183 + R T LD V + K + P QLSGGQKQR+A+AR L +P+++L DEP ALD L Sbjct: 114 EQRVNTSLDMVEMRDKKNRTPGQLSGGQKQRIALARALIFEPKLVLMDEPLGALDKNLRE 173 Query: 184 EVLNVMKQLAEE-GMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRL 242 ++ +K+L E G+T VTH+ A +S+R+ F+ GI+++ P+ ++ P + + Sbjct: 174 QMQYEIKRLHERLGITAVYVTHDQTEALTMSDRIAVFDDGIVQQVASPSVLYEEPATAFV 233 Query: 243 RAFL 246 F+ Sbjct: 234 ANFI 237 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 357 Length adjustment: 27 Effective length of query: 225 Effective length of database: 330 Effective search space: 74250 Effective search space used: 74250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory