Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate WP_090275879.1 BLU11_RS18455 methionine ABC transporter ATP-binding protein
Query= TCDB::P73721 (252 letters) >NCBI__GCF_900105005.1:WP_090275879.1 Length = 334 Score = 172 bits (435), Expect = 1e-47 Identities = 104/250 (41%), Positives = 141/250 (56%), Gaps = 7/250 (2%) Query: 8 LISFDQLQKNFGA----LQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGG 63 +I F Q+ K + + L I V IIG SG GKST LR +NRLE S G Sbjct: 1 MIEFQQVNKAYRVGGRDIPALHATDLTIEAGQVYGIIGHSGAGKSTLLRLINRLEEPSNG 60 Query: 64 RLEVAGVDLSGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEA 123 R+ VAG D + ++ + LR+ R RVGM+FQHFNL TV N+ L R + Sbjct: 61 RIMVAGEDTTA--LNAEGLRRFRQRVGMIFQHFNLLSSATVADNVALPLRLAGSANRQQI 118 Query: 124 KDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVG 183 R + LD+VGL A YP QLSGGQKQRV IAR L +P ILL DE TSALDP G Sbjct: 119 AARVASLLDRVGLSDHASKYPAQLSGGQKQRVGIARALATEPSILLCDEATSALDPHTTG 178 Query: 184 EVLNVMKQLAEE-GMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRL 242 +VL ++ ++ E +T+ ++THEM R V ++V + G I E+G +VF +P+ Sbjct: 179 QVLQLLSEINRELNLTIVLITHEMDVIRRVCDQVAVMDGGRIVEQGTVADVFLHPQHPTT 238 Query: 243 RAFLSRIQSS 252 R+F+ +S+ Sbjct: 239 RSFVFGSESA 248 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 334 Length adjustment: 26 Effective length of query: 226 Effective length of database: 308 Effective search space: 69608 Effective search space used: 69608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory