Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate WP_090273523.1 BLU11_RS11675 SDR family oxidoreductase
Query= uniprot:Q8EGC1 (252 letters) >NCBI__GCF_900105005.1:WP_090273523.1 Length = 252 Score = 274 bits (700), Expect = 1e-78 Identities = 138/253 (54%), Positives = 189/253 (74%), Gaps = 2/253 (0%) Query: 1 MDLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDKLERACADLGSST-EVQGYA 59 M LKD V+++TGG GLG AMA A GA+LAL+D+DQ KL+ A A ++ + + Y Sbjct: 1 MQLKDSVIIVTGGGQGLGRAMAEYLAGRGARLALVDLDQAKLDEAVAACKTAGGDARAYV 60 Query: 60 LDITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVIN 119 +I +E+ V + D+G IN L+NNAGILRDG+L+K+KDG++ +MS +Q+QSVI+ Sbjct: 61 CNIANEQQVTDMVGQVATDYGTINGLINNAGILRDGLLLKSKDGEI-QKMSLNQWQSVID 119 Query: 120 VNLTGTFLCGREAAAAMIESGQAGVIVNISSLAKAGNVGQSNYAASKAGVAAMSVGWAKE 179 VNLTG FL RE AA M+E G G+I+NISS+++AGN+GQSNY+A+KAGVAA++V WAKE Sbjct: 120 VNLTGVFLGTREVAAKMVELGSKGLIINISSISRAGNMGQSNYSAAKAGVAALTVVWAKE 179 Query: 180 LARYNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGHAEEIASTVRFIIENDYV 239 LARY IR A +APG I TEMT+ MKPEALE++ +P+ R+G EEIA + ++ ENDY Sbjct: 180 LARYGIRVAGIAPGFIETEMTSGMKPEALEKMTSGIPLRRMGMPEEIAHSAAYLFENDYY 239 Query: 240 NGRVFEVDGGIRL 252 +GR+ E+DGG+RL Sbjct: 240 SGRILELDGGLRL 252 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 252 Length adjustment: 24 Effective length of query: 228 Effective length of database: 228 Effective search space: 51984 Effective search space used: 51984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory